| Sequence 1: | NP_523454.2 | Gene: | Or22c / 33381 | FlyBaseID: | FBgn0026396 | Length: | 402 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_523690.3 | Gene: | Or47b / 36212 | FlyBaseID: | FBgn0026385 | Length: | 412 | Species: | Drosophila melanogaster |
| Alignment Length: | 270 | Identity: | 66/270 - (24%) |
|---|---|---|---|
| Similarity: | 110/270 - (40%) | Gaps: | 53/270 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 145 NAAFTLQPLIMGLYRWIVQLPGQTELPFNIILP----SFAVQPGVFPLTYVLLTASGACTVFAFS 205
Fly 206 FVDGFFICSCLYICGAFRLVQQDIRRIFADLHGD---SVDVFTEEMNAEVR--HRLAQVVERHNA 265
Fly 266 IID--FCTDLTRQFTVIVLMHF--LSAAFVLCSTILDIMLNTSSLSGLTYICYIIAALTQLFLYC 326
Fly 327 FGGNHVSESSAAVADVLYDM-EWY-KCDARTRKVILMILRRSQRAKTIAVPFFTPSLPALRSILS 389
Fly 390 TAGSYITLLK 399 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Or22c | NP_523454.2 | 7tm_6 | 69..392 | CDD:251636 | 62/261 (24%) |
| Or47b | NP_523690.3 | 7tm_6 | 88..402 | CDD:251636 | 66/270 (24%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45435236 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR21137 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.940 | |||||