DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or22c and Or47b

Sequence 1:NP_523454.2 Gene:Or22c FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_523690.3 Gene:Or47b FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster

Alignment Length:270 Identity:66/271 (24%)
Similarity:110/271 (41%) Gaps:53/271 (20%)


  Fly   145 NAAFTLQPLIMGLYRWIVQLPGQTELPFNIILP----SFAVQPGVFPLTYVLLTASGACTVFAFS 205
            :||..||||:           |:.:|||:.:.|    ...:.|..|...|:..:.:....:.:..
  Fly   168 SAAIFLQPLL-----------GEGKLPFHSVYPFQWHRLDLHPYTFWFLYIWQSLTSQHNLMSIL 221

  Fly   206 FVDGFFICSCLYICGAFRLVQQDIRRIFADLHGD---SVDVFTEEMNAEVR--HRLAQVVERHNA 265
            .||...|.:.|......:|:..:||::     ||   |...|.||....||  ..:.::|.:.|.
  Fly   222 MVDMVGISTFLQTALNLKLLCIEIRKL-----GDMEVSDKRFHEEFCRVVRFHQHIIKLVGKANR 281

  Fly   266 IID--FCTDLTRQFTVIVLMHF--LSAAFVLCSTILDIMLNTSSLSGLTYICYIIAALTQLFLYC 326
            ..:  |...|...|::|.:..|  ::||.|            .......::..::.|..||.|:|
  Fly   282 AFNGAFNAQLMASFSLISISTFETMAAAAV------------DPKMAAKFVLLMLVAFIQLSLWC 334

  Fly   327 FGGNHVSESSAAVADVLYDM-EWY-KCDARTRKVILMILRRSQRAKTIAVPFFTPSLPALRSILS 389
            ..|..|...|..||...:|: :|: |.....|.:..:|||..:....:|.||    ||      .
  Fly   335 VSGTLVYTQSVEVAQAAFDINDWHTKSPGIQRDISFVILRAQKPLMYVAEPF----LP------F 389

  Fly   390 TAGSYITLLK 399
            |.|:|:.:||
  Fly   390 TLGTYMLVLK 399

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 62/262 (24%)
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 66/271 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134646962
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.