DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or22c and Or45a

Sequence 1:NP_523454.2 Gene:Or22c FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_523666.3 Gene:Or45a FlyBaseID:FBgn0033404 Length:378 Species:Drosophila melanogaster

Alignment Length:418 Identity:103/419 (25%)
Similarity:172/419 (41%) Gaps:75/419 (18%)


  Fly    13 FYRIPRISGLIVGLWPQRIRGGGGRPWHAHLLFVFAFA---MVVVGAVGEVSYGCVHLDNLVVAL 74
            ::.:.|.:..|||..|...:.....|..|.:|.:...:   .:||.|:.::|......||..|  
  Fly     5 YFAVQRRALEIVGFDPSTPQLSLKHPIWAGILILSLISHNWPMVVYALQDLSDLTRLTDNFAV-- 67

  Fly    75 EAFCPGTTKAVCVLKLWVFFRSNRRWAELVQRLRAILWESRRQEAQRMLVGLATTANRL------ 133
              |..|:..   ..|..|.....||...|:.||..:     .|.|       :.|.|.|      
  Fly    68 --FMQGSQS---TFKFLVMMAKRRRIGSLIHRLHKL-----NQAA-------SATPNHLEKIERE 115

  Fly   134 -SLLLLSSGTATNAAF------TLQPLIMGLYRWI---VQLPGQTELPFNIIL----PSFAVQPG 184
             .|....:.:..|||:      .:.|:::||:.::   |..| .|.:.||..|    |.|     
  Fly   116 NQLDRYVARSFRNAAYGVICASAIAPMLLGLWGYVETGVFTP-TTPMEFNFWLDERKPHF----- 174

  Fly   185 VFPLTY--VLLTASGACTVFAFSFVDGFFICSCLYICGAFRLVQQDIRRIFADLH-GDSVDVFTE 246
            .:|:..  ||..|:.|....|   .|..|......:...|:|::..:..  .||: |||      
  Fly   175 YWPIYVWGVLGVAAAAWLAIA---TDTLFSWLTHNVVIQFQLLELVLEE--KDLNGGDS------ 228

  Fly   247 EMNAEVRHRLAQVVERHNAIIDFCTDLTRQFTVIVLMHFLSAAFVLCSTILDIMLNTSSLSGLT- 310
                    ||...|.||...:|...:|:..|..||.:.::.:...||  :|....:.|..|... 
  Fly   229 --------RLTGFVSRHRIALDLAKELSSIFGEIVFVKYMLSYLQLC--MLAFRFSRSGWSAQVP 283

  Fly   311 -YICYIIAALTQLFLYCFGGNHVSESSAAVADVLY-DMEWYKCDARTRKVILMILRRSQRAKTIA 373
             ...:::|.:.||..||:||.::.:.|.|:|..:| .:.|.:...:.|::..|::.|:||...|.
  Fly   284 FRATFLVAIIIQLSSYCYGGEYIKQQSLAIAQAVYGQINWPEMTPKKRRLWQMVIMRAQRPAKIF 348

  Fly   374 VPFFTPSLPALRSILSTAGSYITLLKTF 401
            ...|...||.|..::.||||::.:|:||
  Fly   349 GFMFVVDLPLLLWVIRTAGSFLAMLRTF 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 85/349 (24%)
Or45aNP_523666.3 7tm_6 64..367 CDD:251636 85/349 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52415
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.