DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or22c and Or43a

Sequence 1:NP_523454.2 Gene:Or22c FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_523647.2 Gene:Or43a FlyBaseID:FBgn0026389 Length:376 Species:Drosophila melanogaster

Alignment Length:323 Identity:78/324 (24%)
Similarity:144/324 (44%) Gaps:35/324 (11%)


  Fly    87 VLKLWVFFRSNRRWAELVQRLRAILWESRRQEAQRMLVGLATTANR----LSLLLLSSGTATNAA 147
            :::.|:.....|::.|.:.:| |.|:.|..........|:...|.|    |::|.||      |:
  Fly    74 LMRTWLVIIKRRQFEEFLGQL-ATLFHSILDSTDEWGRGILRRAEREARNLAILNLS------AS 131

  Fly   148 F--TLQPLIMGLYRWIVQLPGQTELPFNIILPSFAVQPG-VFPLTYVL-LTASGACTVFAFSFVD 208
            |  .:..|:..|:|      .:...||.:.||..::... |:.:.|:. |......::....||.
  Fly   132 FLDIVGALVSPLFR------EERAHPFGLALPGVSMTSSPVYEVIYLAQLPTPLLLSMMYMPFVS 190

  Fly   209 GFFICSCLYICGAFRLVQQDIRRIFADLHGDSVDVFTEEMNAEVR-HRLAQVVERHNAIIDFCTD 272
            .|   :.|.|.|. .::|..:.|: ..:.|       ||.:.|.| .|||..:..|..::.:...
  Fly   191 LF---AGLAIFGK-AMLQILVHRL-GQIGG-------EEQSEEERFQRLASCIAYHTQVMRYVWQ 243

  Fly   273 LTRQFTVIVLMHFLSAAFVLCSTILDIMLNTSSLSGLTYICYIIAALTQLFLYCFGGNHVSESSA 337
            |.:....||.:..:....::||.:..:.:.||....::.:.||:..|..||.|....|.:...:.
  Fly   244 LNKLVANIVAVEAIIFGSIICSLLFCLNIITSPTQVISIVMYILTMLYVLFTYYNRANEICLENN 308

  Fly   338 AVADVLYDMEWYKCDARTRKVILMILRRSQRAKTIAVPFFTP-SLPALRSILSTAGSYITLLK 399
            .||:.:|::.||:...|.||.:|:.|.::|....|.|....| :|...:|:|:.:.||.|:|:
  Fly   309 RVAEAVYNVPWYEAGTRFRKTLLIFLMQTQHPMEIRVGNVYPMTLAMFQSLLNASYSYFTMLR 371

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 74/315 (23%)
Or43aNP_523647.2 7tm_6 56..364 CDD:251636 74/315 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52235
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.