DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or22c and Or33c

Sequence 1:NP_523454.2 Gene:Or22c FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_523555.1 Gene:Or33c FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster

Alignment Length:151 Identity:36/152 (24%)
Similarity:60/152 (39%) Gaps:23/152 (15%)


  Fly   252 VRH-RLAQVVERHNAIIDFCTDLTRQFTVIVLMHFLSAAFVLCSTILDIML----NTSSLSGLTY 311
            |.| ||...:|:|..::.|...::|..:.:.|:........|| .|:..||    :|.||  :.|
  Fly   227 VNHQRLLDYIEQHKLLVRFHNLVSRTISEVQLVQLGGCGATLC-IIVSYMLFFVGDTISL--VYY 288

  Fly   312 ICYIIAALTQLFLYCFGGNHVSESSAAVADVLYDMEWYKCDARTRKVILMILRRSQRAKTIAVPF 376
            :.:......|||..|:..:.|:|....:...::...||. .:|..:..|:|              
  Fly   289 LVFFGVVCVQLFPSCYFASEVAEELERLPYAIFSSRWYD-QSRDHRFDLLI-------------- 338

  Fly   377 FTPSLPALRSILSTAGSYITL 397
            ||......|..:..||..|.|
  Fly   339 FTQLTLGNRGWIIKAGGLIEL 359

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 33/145 (23%)
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 36/152 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C51580
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.