DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or22c and Or33a

Sequence 1:NP_523454.2 Gene:Or22c FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_523553.1 Gene:Or33a FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster

Alignment Length:299 Identity:52/300 (17%)
Similarity:113/300 (38%) Gaps:56/300 (19%)


  Fly    86 CVLKLWVFFRSNRRW-AELVQRLRAILWE-SRRQEAQRMLVGLATTANRLSLLLLSSGTATNAAF 148
            |..|.:.|     || .:.::.:..:|.: ..|.|::..........:|::.:|..|......:.
  Fly    76 CSYKFFCF-----RWKLKEIKTIEGLLQDLDSRVESEEERNYFNQNPSRVARMLSKSYLVAAISA 135

  Fly   149 TLQPLIMGLY---RWIVQLPGQTELPFNIILPSFAVQPGVFPLTYVLLTASGACTVFAFSFV--- 207
            .:...:.||:   |.::.|                   |.||..:   .|:.|....:||:.   
  Fly   136 IITATVAGLFSTGRNLMYL-------------------GWFPYDF---QATAAIYWISFSYQAIG 178

  Fly   208 -----------DGFFICSCLYICGAFRLVQQDIRRIFADLHGDSVDVFTEEMNAEVRHRLAQVVE 261
                       |.:...:...:.|..||:...:.||..|:...|         :|...:|.:.::
  Fly   179 SSLLILENLANDSYPPITFCVVSGHVRLLIMRLSRIGHDVKLSS---------SENTRKLIEGIQ 234

  Fly   262 RHNAIIDFCTDLTRQFTVIVLMHFLSAAFVLCSTILDIM-LNTSSLSGLTYICYIIAALTQLFLY 325
            .|..::.....|.....:..|..|||:...:..|:::|: ...::.:.|.|..:..|.|.:||..
  Fly   235 DHRKLMKIIRLLRSTLHLSQLGQFLSSGINISITLINILFFAENNFAMLYYAVFFAAMLIELFPS 299

  Fly   326 CFGGNHVSESSAAVADVLYDMEWYKCDARTRKVILMILR 364
            |:.|..::.....:...::...|.|.|.|..:.::::::
  Fly   300 CYYGILMTMEFDKLPYAIFSSNWLKMDKRYNRSLIILMQ 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 52/300 (17%)
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 52/300 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C51752
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.