DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or22c and Or22a

Sequence 1:NP_523454.2 Gene:Or22c FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_523453.1 Gene:Or22a FlyBaseID:FBgn0026398 Length:397 Species:Drosophila melanogaster

Alignment Length:315 Identity:62/316 (20%)
Similarity:130/316 (41%) Gaps:61/316 (19%)


  Fly   115 RRQEAQRMLVGLATTANRLSLLLLSSGTATNAAFTLQPLIMGLYRWIVQLPGQTELPFNIILPSF 179
            :||||:.:|       ::|....||....:.           ::|: |.:....::.::|...:|
  Fly   109 KRQEAKVLL-------DQLDKRCLSDKERST-----------VHRY-VAMGNFFDILYHIFYSTF 154

  Fly   180 AVQPGVFPLTYVLLTASGACTVFAFSFVDG---FFICS---------------CLYICGA----- 221
            .|..  ||  |.||....|..:: |.::|.   |:|.|               |..:|..     
  Fly   155 VVMN--FP--YFLLERRHAWRMY-FPYIDSDEQFYISSIAECFLMTEAIYMDLCTDVCPLISMLM 214

  Fly   222 ----FRLVQQDIRRIFADLHGDSVDVFTEEMNAEVRHRLAQVVERHNAIIDFCTDLTRQFTVIVL 282
                ..|::|.:|.: ....|.:.|.:.||        |.:.:..|..::|:...|...|:..:.
  Fly   215 ARCHISLLKQRLRNL-RSKPGRTEDEYLEE--------LTECIRDHRLLLDYVDALRPVFSGTIF 270

  Fly   283 MHFLSAAFVLCSTILDIMLNTSSLSGLTYICYIIAALTQLFLYCFGGNHVSESSAAVADVLYDME 347
            :.||....||..:::::|..::..:|:....::.....:.|.:|:..|.:.:....:::.|:..:
  Fly   271 VQFLLIGTVLGLSMINLMFFSTFWTGVATCLFMFDVSMETFPFCYLCNMIIDDCQEMSNCLFQSD 335

  Fly   348 WYKCDARTRKVILMILRRSQRAKTI-AVPFFTPSLPALRSILSTAGSYITLLKTF 401
            |...|.|.:..::..|...|:..|: |...|..|:....:::..|.|.:|::|.|
  Fly   336 WTSADRRYKSTLVYFLHNLQQPITLTAGGVFPISMQTNLAMVKLAFSVVTVIKQF 390

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 58/305 (19%)
Or22aNP_523453.1 7tm_6 81..381 CDD:251636 58/305 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C51441
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.