DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or22c and Or7a

Sequence 1:NP_523454.2 Gene:Or22c FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_511081.1 Gene:Or7a FlyBaseID:FBgn0030016 Length:413 Species:Drosophila melanogaster

Alignment Length:407 Identity:80/408 (20%)
Similarity:161/408 (39%) Gaps:51/408 (13%)


  Fly     3 DSGQPAIADHFYRIPRISGLIVGLWPQRIRGGGGRPWHAHLLFVFAFAMVVVGAVGEVSYGCVHL 67
            |..:|..:..:.||.....:::.:|              .||.|..|.::....:|.:....| |
  Fly    36 DGSRPTTSSTWQRIYACFSVVMYVW--------------QLLLVPTFFVISYRYMGGMEITQV-L 85

  Fly    68 DNLVVALEAFCPGTTKAVCVLKLWVFFRSNRRWAELVQRLRAILWESRRQEAQRMLVGLATTAN- 131
            .:..||::|.............|.:..|:....|.|..|       .|.||..::::......| 
  Fly    86 TSAQVAIDAVILPAKIVALAWNLPLLRRAEHHLAALDAR-------CREQEEFQLILDAVRFCNY 143

  Fly   132 -----RLSLLLLSSGTATNAAFTLQPLIMGLYRWIVQLPGQTELPFNIILPSFAVQPGVFPLTYV 191
                 ::...:.||.|...|      .::|...:.:.|||   |.:......|.:|..:     .
  Fly   144 LVWFYQICYAIYSSSTFVCA------FLLGQPPYALYLPG---LDWQRSQMQFCIQAWI-----E 194

  Fly   192 LLTASGACTVFAFSFVDGFFICSCLYICG-AFRLVQQDIRRIFADLHGDSVDVFTEEMNAEVRH- 254
            .|..:..|...|   .|..:....||:.. ..:|:.:.:.::..|..| .|:::.:|...| .| 
  Fly   195 FLIMNWTCLHQA---SDDVYAVIYLYVVRIQVQLLARRVEKLGTDDSG-QVEIYPDERRQE-EHC 254

  Fly   255 -RLAQVVERHNAIIDFCTDLTRQFTVIVLMHFLSAAFVLCSTILDIMLNTSSLSGLTYICYIIAA 318
             .|.:.:..|..::.....::...:..:.:.||..|.::.:|:::|.:..::.:.:..|.|::|.
  Fly   255 AELQRCIVDHQTMLQLLDCISPVISRTIFVQFLITAAIMGTTMINIFIFANTNTKIASIIYLLAV 319

  Fly   319 LTQLFLYCFGGNHVSESSAAVADVLYDMEWYKCDARTRKVILMILRRSQRAKTI-AVPFFTPSLP 382
            ..|....|:....:...:..:|..::..:|....||.||::|..|.|:|:..|: |:..|..:|.
  Fly   320 TLQTAPCCYQATSLMLDNERLALAIFQCQWLGQSARFRKMLLYYLHRAQQPITLTAMKLFPINLA 384

  Fly   383 ALRSILSTAGSYITLLK 399
            ...||...:.|..||:|
  Fly   385 TYFSIAKFSFSLYTLIK 401

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 64/333 (19%)
Or7aNP_511081.1 7tm_6 80..394 CDD:251636 66/341 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C51523
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.