DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or22c and Or1a

Sequence 1:NP_523454.2 Gene:Or22c FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_525029.2 Gene:Or1a FlyBaseID:FBgn0029521 Length:392 Species:Drosophila melanogaster

Alignment Length:424 Identity:94/425 (22%)
Similarity:161/425 (38%) Gaps:104/425 (24%)


  Fly    26 LWPQRI---RGG-------GGRPWHAHLLFVF-----AFAMVVVGAVGEVSYGCVHLDNLVVALE 75
            ||.||.   |.|       .|....:.||:..     :|.:..|.|     :...:.:.:|:..|
  Fly    12 LWTQRFTFARMGLDLQPDKKGNVLRSPLLYCIMCLTTSFELCTVCA-----FMVQNRNQIVLCSE 71

  Fly    76 AFCPGTTKAVCVLKLWVFFRSNRRWAELVQRLRAIL---------WESRRQEAQRMLVGLATTAN 131
            |...|......:||:.:|...:....:|:|::::..         |.|:.|..|.|..       
  Fly    72 ALMHGLQMVSSLLKMAIFLAKSHDLVDLIQQIQSPFTEEDLVGTEWRSQNQRGQLMAA------- 129

  Fly   132 RLSLLLLSSGTATNAAFTLQPLIMGLYRWIVQLPGQTELPFNIILPSFAVQPGVFPLTYVLLTAS 196
              ...::.:|  |:.:|.|.|:.:.:.::...........|.::||....||.|:.:...|:.  
  Fly   130 --IYFMMCAG--TSVSFLLMPVALTMLKYHSTGEFAPVSSFRVLLPYDVTQPHVYAMDCCLMV-- 188

  Fly   197 GACTVFAFSFVDGFFICS-----------CLYICGAFRLVQQDIRRIFADLHGDSVD-----VFT 245
                     ||..||.||           .|.:...:|.:.|.::||.:..:....|     :|.
  Fly   189 ---------FVLSFFCCSTTGVDTLYGWCALGVSLQYRRLGQQLKRIPSCFNPSRSDFGLSGIFV 244

  Fly   246 EEMNAEVRHRLAQVVERHNAIIDFCTDLTRQFTVIVLMHFLSAAFV--------LCSTILD-IML 301
            |..      ||.::|:..|                  ..|:..|||        .||.|.. ||.
  Fly   245 EHA------RLLKIVQHFN------------------YSFMEIAFVEVVIICGLYCSVICQYIMP 285

  Fly   302 NTS-SLSGLTYICYIIAALTQLFLYCFGGNHVSESSAAVADVLYD-MEWYKCDARTRKVILMILR 364
            :|: :.:.|.:...::.  |||.:|.||...|...:...:.:||: :.|.....:.||:.|..:.
  Fly   286 HTNQNFAFLGFFSLVVT--TQLCIYLFGAEQVRLEAERFSRLLYEVIPWQNLPPKHRKLFLFPIE 348

  Fly   365 RSQRAKTIAVPFFTPSLPALRSILSTAGSYITLL 398
            |:||...:...||....|.|..|..||||:.||:
  Fly   349 RAQRETVLGAYFFELGRPLLVWIFRTAGSFTTLM 382

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 78/359 (22%)
Or1aNP_525029.2 7tm_6 79..376 CDD:251636 74/345 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52457
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.