DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or22c and Or46a

Sequence 1:NP_523454.2 Gene:Or22c FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_995793.1 Gene:Or46a FlyBaseID:FBgn0026388 Length:384 Species:Drosophila melanogaster

Alignment Length:433 Identity:94/434 (22%)
Similarity:168/434 (39%) Gaps:96/434 (22%)


  Fly     9 IADHFYRIPRISGLIVGLWP------------QRIRGGGGRPWHAHLLFV----FAFAMV-VVGA 56
            :.:.||:.......|:|:|.            |.:|.|    :...:||:    |:|.|: .:..
  Fly     2 VTEDFYKYQVWYFQILGVWQLPTWAADHQRRFQSMRFG----FILVILFIMLLLFSFEMLNNISQ 62

  Fly    57 VGEVSYGCVHLDNLVVALEAFCPGTTKAVCVLKLWVFFRSNRRWAELVQRLRAILWESRRQEAQR 121
            |.|:             |:.|....|:..|:.||......:|:.|.||..:.:..:..:.::..:
  Fly    63 VREI-------------LKVFFMFATEISCMAKLLHLKLKSRKLAGLVDAMLSPEFGVKSEQEMQ 114

  Fly   122 MLV--GLATTANRLSLLLLSSGTATNAA-------FTLQPLIM----GLYRWIVQLPGQTELPFN 173
            ||.  .:|....|.|..::|.|.|:...       |...||.|    .:..||..   .::..|:
  Fly   115 MLELDRVAVVRMRNSYGIMSLGAASLILIVPCFDNFGELPLAMLEVCSIEGWICY---WSQYLFH 176

  Fly   174 II--LPSFAVQPGVFPLTYVLLTASGACTVFAFSFVDGFFICSCLYICGAFRLVQQDIRRIFADL 236
            .|  ||:.     |..:||..:..|..|                      |..||..:..:..:.
  Fly   177 SICLLPTC-----VLNITYDSVAYSLLC----------------------FLKVQLQMLVLRLEK 214

  Fly   237 HGDSVDVFTEEMNAEVRHRLAQVVERHNAIIDFCTDLTRQFT----VIVLMHFLSAAFVLCSTIL 297
            .|   .|...:.|.::...|.:....:|.|:.| .||...|.    .:.||   .:..||.|.:.
  Fly   215 LG---PVIEPQDNEKIAMELRECAAYYNRIVRF-KDLVELFIKGPGSVQLM---CSVLVLVSNLY 272

  Fly   298 DI----MLNTSSLSGLTYICYIIAALTQLFLYCFGGNHVSESSAAVADVLYDMEWYKCDARTRKV 358
            |:    :.|..::..|....|.:..|.|:|:.|:..|.|:..|:.:...:|..:|...:...|::
  Fly   273 DMSTMSIANGDAIFMLKTCIYQLVMLWQIFIICYASNEVTVQSSRLCHSIYSSQWTGWNRANRRI 337

  Fly   359 ILMILRRSQRAKTIAV--PFFTPSLPALRSILSTAGSYITLLK 399
            :|::::|......::.  |.|..||.|..||::.:.||..|||
  Fly   338 VLLMMQRFNSPMLLSTFNPTFAFSLEAFGSIVNCSYSYFALLK 380

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 74/348 (21%)
Or46aNP_995793.1 7tm_6 62..373 CDD:251636 76/361 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C53055
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.