DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or22c and Or19b

Sequence 1:NP_523454.2 Gene:Or22c FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_728315.1 Gene:Or19b FlyBaseID:FBgn0062565 Length:387 Species:Drosophila melanogaster

Alignment Length:449 Identity:84/450 (19%)
Similarity:156/450 (35%) Gaps:127/450 (28%)


  Fly     8 AIADHFYRIPRISGLIVGLWPQRIRGGGGRPWHAHLLFVFAFAMVVVGAVGEVSYG-CVHLD--- 68
            |:.:| :||.|    |:|:.|...|...||.:.|:.:            |..|::. |:.:.   
  Fly    11 ALVNH-WRIFR----IMGIHPPGKRTFWGRHYTAYSM------------VWNVTFHICIWVSFSV 58

  Fly    69 NLVV--ALEAFCPGTTKAVCVL---KLWVFFRSNRRWAELVQRLRAIL----WESR--------R 116
            ||:.  :||.||    :::||.   .|::....|      |:|:|..:    |..|        .
  Fly    59 NLLQSNSLETFC----ESLCVTMPHTLYMLKLIN------VRRMRGEMISSHWLLRLLDKRLGCA 113

  Fly   117 QEAQRMLVGLATTANRLSLLLLSSGTATNAAFTLQPLIMGLYRWIVQLPGQTELPFNIILPSFAV 181
            .|.|.::.|:                 ..|.|..:.:..||...:|         ..||..|.:.
  Fly   114 DERQIIMAGI-----------------ERAEFIFRTIFRGLACTVV---------LGIIYISASS 152

  Fly   182 QPGVFPLTYV-----------LLTA--------SGACTVFAFSFVDGFFICSCLYICGAFRLVQQ 227
            :|.:...|::           |.||        :.|..|...|...|.::               
  Fly   153 EPTLMYPTWIPWNWKDSTSAYLATAMLHTTALMANATLVLNLSSYPGTYL--------------- 202

  Fly   228 DIRRIFADLHGDSVDVFTEEMN-------AEVRHRLAQVVERHNAIIDFCTDLTRQFTVIVLMHF 285
                |...:|..::.:...::.       ..::..|...:..|..|:.....|.|..::...:.|
  Fly   203 ----ILVSVHTKALALRVSKLGYGAPLPAVRMQAILVGYIHDHQIILRLFKSLERSLSMTCFLQF 263

  Fly   286 LSAAFVLCSTILDIML--NTSSLSGLTYICYIIAALTQLFLYCFGGNHVSESSAAVADVLYDMEW 348
            .|.|...| ||...:|  |...:..:..:..::...|:..|.|:......:...::...:|...|
  Fly   264 FSTACAQC-TICYFLLFGNVGIMRFMNMLFLLVILTTETLLLCYTAELPCKEGESLLTAVYSCNW 327

  Fly   349 YKCDARTRKVILMILRRSQRAKTIAVPFFTP-SLPALRSILSTAGSYITLL----KTFL 402
            .......|:::|::|.|.|....:......| |:.....::..|.:.:|||    ||.|
  Fly   328 LSQSVNFRRLLLLMLARCQIPMILVSGVIVPISMKTFTVMIKGAYTMLTLLNEIRKTSL 386

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 63/369 (17%)
Or19bNP_728315.1 7tm_6 65..372 CDD:251636 61/363 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C51694
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.