DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15356 and EMSY

Sequence 1:NP_608633.1 Gene:CG15356 FlyBaseID:FBgn0031377 Length:1023 Species:Drosophila melanogaster
Sequence 2:XP_011543475.1 Gene:EMSY HGNCID:18071 Length:1353 Species:Homo sapiens

Alignment Length:1144 Identity:284/1145 (25%)
Similarity:427/1145 (37%) Gaps:354/1145 (31%)


  Fly     1 MWPQTLEMSRDECRGMLRRLELESYSHVVSVFRAQGALSETKAKLLEELRQQFHINQERHRAEVR 65
            :||..|::|||||:.:||:||||:|:.|:|..||||.|::.|..||.||.:...|:.||||||||
Human     4 VWPTLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSISTERHRAEVR 68

  Fly    66 RAANDEQLCTIAE--------------NVCGPNTWQEWSREGRRLYPLLPRISPQTALSIVANDL 116
            ||.|||:|.|||.              ::.|||:..|||.|||||.||:||:.||||.::.||.:
Human    69 RAVNDERLTTIAHKMNLSLYLGERPSYSMSGPNSSSEWSIEGRRLVPLMPRLVPQTAFTVTANAV 133

  Fly   117 AAKACEENAKLAAPAET-----AVHFG---------EALVEQASLMSLKYPRGARIQDTAMVIMA 167
            |..|.:.||.|..||||     .|.:.         ...|...|:.::|.||.|......:|   
Human   134 ANAAIQHNASLPVPAETGSKEVVVCYSYTSTTSTPTSTPVPSGSIATVKSPRPASPASNVVV--- 195

  Fly   168 EPFKVPDLPNEVKKMTQKRKENDSGIDGKPNKKRHMQQPHPQQPHLQASQQQQQSQQLNPNSSNP 232
                   ||:......:....:|.  |.||.|:|                      :.|.:||:|
Human   196 -------LPSGSTVYVKSVSCSDE--DEKPRKRR----------------------RTNSSSSSP 229

  Fly   233 GMEEADP---VPPEKRMTARTLQQRYFYQQQMKHKQRLAS-KRNLANRL-----------GSPSA 282
            .:.:..|   ||..|.:|.           .:....:::: .:::||.|           ..||.
Human   230 VVLKEVPKAVVPVSKTITV-----------PVSGSPKMSNIMQSIANSLPPHMSPVKITFTKPST 283

  Fly   283 QSGNPLGGRNMPSSGGDTSTAKRSAAPAKSGRRAQKQLQQQQKLQQHQQQKVLM----QSQETVP 343
            |:.|             |:|                             |||::    .|...||
Human   284 QTTN-------------TTT-----------------------------QKVIIVTTSPSSTFVP 306

  Fly   344 NHMVVQPHVEYVLDEALKTLAASNPPTPTSTVAPPYTILNEPRPLVTLKPLKTIKPMIYGPQSGM 408
            |          :|.:: ...||.....|||.:|   :...:|..::|......:.....|..|..
Human   307 N----------ILSKS-HNYAAVTKLVPTSVIA---STTQKPPVVITASQSSLVSNSSSGSSSST 357

  Fly   409 PSAEIGSPTTPGSRGFANSPIVFKEKLQASP-VQVATQGQGSPTKKFVAEERHADAMPSAATTPT 472
            ||.   .|.|          :.....:.::| |.::|..||..|...........:..|..:.||
Human   358 PSP---IPNT----------VAVTAVVSSTPSVVMSTVAQGVSTSAIKMASTRLPSPKSLVSAPT 409

  Fly   473 PISTANLPLAPQIISVQKIPAPSMGGKLRAAVASPTS---STNSTLLPPGAKTT-----PKKFNI 529
            .| .|..|...|....|::.......:.:.|..||.|   ....:.||||.|.|     .....|
Human   410 QI-LAQFPKQHQQSPKQQLYQVQQQTQQQVAQPSPVSHQQQPQQSPLPPGIKPTIQIKQESGVKI 473

  Fly   530 LEGDAKPKTLPSSAVRLLPYTEPIGGPLSPLKDSRVTPLSSASTVNIIKNIPASSLNNTLITPLP 594
            :....:|.       ::||  :|:...|         |.||.|.:.::     ||....:.|.|.
Human   474 ITQQVQPS-------KILP--KPVTATL---------PTSSNSPIMVV-----SSNGAIMTTKLV 515

  Fly   595 SAGTTMPANLFRAKVTPSIKGASGAAGGATVIGAAGATGIGGAGAGPQILGNIKLTSSSGGAATI 659
            :..|...|...|..|:|||...:...|.||.                     :|.||.|    .|
Human   516 TTPTGTQATYTRPTVSPSIGRMAATPGAATY---------------------VKTTSGS----II 555

  Fly   660 KQVPSSALRNIKICSPNGKLFLQPGKLPAGSIIHKFNNASSTAVSAAGGVVTTTTTTVSPTKQPA 724
            ..||.|      :.:..||:.                  ||..||.    .||..||:..|.:| 
Human   556 TVVPKS------LATLGGKII------------------SSNIVSG----TTTKITTIPMTSKP- 591

  Fly   725 REQRISIQKILQPATGSASSGSSSPTTTTTTISGLTSSAKQPGLGNKPTTLTFATAGGGKNNLVF 789
              ..|.:||    .||..           |||.||      || .|..|||..|   ||:..:..
Human   592 --NVIVVQK----TTGKG-----------TTIQGL------PG-KNVVTTLLNA---GGEKTIQT 629

  Fly   790 LPASAASGMRALTLATKPKSNVLV-----IGASTSPASAASSP-----NPSGGT----KPK---- 836
            :|..|..   |:..||:|.:.::|     ||::..|| |...|     ...|.|    |||    
Human   630 VPTGAKP---AILTATRPITKMIVTQPKGIGSTVQPA-AKIIPTKIVYGQQGKTQVLIKPKPVTF 690

  Fly   837 --------ANQLITEDTPIDIINMPIIVADNG-------------------TAAELNQASVKNSP 874
                    ..||:||     .:.....||:.|                   ::.|.:|:|..:.|
Human   691 QATVVSEQTRQLVTE-----TLQQASRVAEAGNSSIQEGKEEPQNYTDSSSSSTESSQSSQDSQP 750

  Fly   875 LVVFNAT---DW---EMELDQAAT---KSASTTSKQALDDV--IIEEDEDAEEEARESSEQPSTM 928
            :|...|:   ||   |:.::.:.|   :..|:.|:.|...:  ::|..:...:|..||..:..|:
Human   751 VVHVIASRRQDWSEHEIAMETSPTIIYQDVSSESQSATSTIKALLELQQTTVKEKLESKPRQPTI 815

  Fly   929 DLNNSIIEL-------HPEDDSAIEYVDMDLEQPVEIESTSNISPETATTTLKAAIVS---TSPQ 983
            ||:...:.:       |..:..:|..|:.:|.........::...|.|...|.|.::|   :||.
Human   816 DLSQMAVPIQMTQEKRHSPESPSIAVVESELVAEYITTERTDEGTEVAFPLLDAVVISGEISSPP 880

  Fly   984 ----QQQQQPQKKHPPLEHPLSAGAAAGTGSSTGAAVQS 1018
                ..:.|||:...|....|...|.:.|.:.|...|:|
Human   881 LFSVSHRSQPQQPSQPQRTLLQHVAQSQTATQTSVVVKS 919

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15356NP_608633.1 ENT 16..82 CDD:281696 37/80 (46%)
EMSYXP_011543475.1 ENT 19..81 CDD:309017 37/62 (60%)
PAT1 <976..>1142 CDD:330585
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C365152195
eggNOG 1 0.900 E1_KOG4675
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I4203
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006699
OrthoInspector 1 1.000 T1074638
orthoMCL 1 0.900 OOG5_133870
Panther 1 1.100 LDO PTHR16500
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5579
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.