DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15356 and Emsy

Sequence 1:NP_608633.1 Gene:CG15356 FlyBaseID:FBgn0031377 Length:1023 Species:Drosophila melanogaster
Sequence 2:XP_006229864.1 Gene:Emsy RGDID:1310712 Length:1351 Species:Rattus norvegicus

Alignment Length:1170 Identity:288/1171 (25%)
Similarity:430/1171 (37%) Gaps:401/1171 (34%)


  Fly     1 MWPQTLEMSRDECRGMLRRLELESYSHVVSVFRAQGALSETKAKLLEELRQQFHINQERHRAEVR 65
            :||..|::|||||:.:||:||||:|:.|:|..||||.|::.|..||.||.:...|:.||||||||
  Rat     4 VWPTLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSISTERHRAEVR 68

  Fly    66 RAANDEQLCTIAE--------------NVCGPNTWQEWSREGRRLYPLLPRISPQTALSIVANDL 116
            ||.|||:|.|||.              ::.|||:..|||.|||||.||:||:.||||.::.||.:
  Rat    69 RAVNDERLTTIAHKMNLSLYLGERPSYSMSGPNSSSEWSIEGRRLVPLMPRLVPQTAFTVTANAV 133

  Fly   117 AAKACEENAKLAAPAETA-----VHFG---------EALVEQASLMSLKYPRGARIQDTAMVIMA 167
            |..|.:.||.|..|||||     |.:.         ...|...|:.::|.||.|....:.:|   
  Rat   134 ANAAVQHNASLPVPAETASKEVVVCYSYTSTTSTPTSTPVPSGSIATVKSPRPASPASSVVV--- 195

  Fly   168 EPFKVPDLPNEVKKMTQKRKENDSGIDGKPNKKRHMQQPHPQQPHLQASQQQQQSQQLNPNSSNP 232
                   ||:......:....:|.  |.||.|:|                      :.|.:||:|
  Rat   196 -------LPSGSTVYVKSVSCSDE--DEKPRKRR----------------------RTNSSSSSP 229

  Fly   233 GMEEADP---VPPEKRMTARTLQQRYFYQQQMKHKQRLAS-KRNLANRL-----------GSPSA 282
            .:.:..|   ||..|.:|.           .:....:::: .:::||.|           ..||.
  Rat   230 VVLKEVPKAVVPVSKTITV-----------PVSGSPKMSNIMQSIANSLPPHMSPVKITFTKPST 283

  Fly   283 QSGNPLGGRNMPSSGGDTSTAKRSAAPAKSGRRAQKQLQQQQKLQQHQQQKVLM----QSQETVP 343
            |:.|             |:|                             |||::    .|...||
  Rat   284 QTTN-------------TTT-----------------------------QKVIIVTTSPSSTFVP 306

  Fly   344 NHMVVQPHVEYVLDEALKTLAASNPPTPTSTVA-----PPYTILNEPRPLVTLKPLKTIKPMIYG 403
            |          :|.:: ...||.....|||.:|     ||..|......|||             
  Rat   307 N----------ILSKS-HNYAAVTKLVPTSVIASTTQKPPVVITASQASLVT------------- 347

  Fly   404 PQSGMPSAEIGSPTTPGSRGFANSPIVFKEKLQASP-VQVATQGQGSPTKKFVAEERHADAMPSA 467
                  |:..|:..:..|.  .:|.:.....:.::| |.::|..||..|...........:..|.
  Rat   348 ------SSSNGNSNSTSSS--ISSTVAVTAVVSSTPSVVMSTVAQGVSTSAIKVASTRLPSPKSL 404

  Fly   468 ATTPTPISTANLPLAPQII---SVQKIP--APSMGGKLRAAVASPTSSTNS-------------- 513
            .:.||.| .|..|...|..   .:|::|  .|..|       |.|:|.:..              
  Rat   405 VSGPTQI-LAQFPKQHQQSPKQQLQQVPPQTPQPG-------AQPSSVSQQQQQQQQQQQQQQQQ 461

  Fly   514 ------------TLLPPGAKTT-----PKKFNILEGDAKPKTLPSSAVRLLPYTEPIGGPLSPLK 561
                        :.||||.|.|     .....|:....:|.       ::||  :|:...|    
  Rat   462 QQQQQQQQQPQHSPLPPGIKPTIQIKQESGVKIITQQVQPS-------KILP--KPVTATL---- 513

  Fly   562 DSRVTPLSSASTVNIIKNIPASSLNNTLITPLPSAGTTMPANLFRAKVTPSIKGASGAAGGATVI 626
                 |.||.|.:.::     ||....:.|.|.:..|...|...|..|:||:...:...|.||. 
  Rat   514 -----PTSSNSPIMVV-----SSNGAIMTTKLVTTPTGTQATYTRPTVSPSLGRVATTPGAATY- 567

  Fly   627 GAAGATGIGGAGAGPQILGNIKLTSSSGGAATIKQVPSSALRNIKICSPNGKLFLQPGKLPAGSI 691
                                :|.||.|    .|..||.|      :.:..||:.           
  Rat   568 --------------------VKTTSGS----IITVVPKS------LATLGGKII----------- 591

  Fly   692 IHKFNNASSTAVSAAGGVVTTTTTTVSPTKQPAREQRISIQKILQPATGSASSGSSSPTTTTTTI 756
                   ||..||.    .||..||:..|.:|   ..|.:||    .||..           |||
  Rat   592 -------SSNIVSG----TTTKITTIPMTSKP---NVIVVQK----TTGKG-----------TTI 627

  Fly   757 SGLTSSAKQPGLGNKPTTLTFATAGGGKNNLVFLPASAASGMRALTLATKPKSNVLV-----IGA 816
            .||      || .|..|||..|   ||:..|..:|..|..   |:..||:|.:.::|     ||:
  Rat   628 QGL------PG-KNVVTTLLNA---GGEKTLQTVPTGAKP---AIITATRPITKMIVTQPKGIGS 679

  Fly   817 STSPASAASSP-----NPSGGT----KPK------------ANQLITEDTPIDIINMPIIVADNG 860
            :..|| |...|     ...|.|    |||            ..||:||     .:.....||:.|
  Rat   680 TVQPA-AKIIPTKIVYGQQGKTQVLIKPKPVTFQATVVSEQTRQLVTE-----TLQQASRVAEAG 738

  Fly   861 -------------------TAAELNQASVKNSPLVVFNAT---DW---EMELDQAAT---KSAST 897
                               ::.|.:|:|..:.|:|...|:   ||   |:.::.:.|   :..|:
  Rat   739 NSSAQEGKEEPQGYTDSSSSSTESSQSSQDSQPVVHVIASRRQDWSEHEIAMETSPTIIYQDVSS 803

  Fly   898 TSKQALDDV--IIEEDEDAEEEARESSEQPSTMDLNNSIIEL-------HPEDDSAIEYVDMDLE 953
            .|:.|...:  ::|..:...:|..||..:..|:||:...:.:       |..:..:|..|:.:| 
  Rat   804 ESQSATSTIKALLELQQTTVKEKLESKPRQPTIDLSQMAVPIQMTQEKRHSPESPSIAVVESEL- 867

  Fly   954 QPVEIESTSNISPETATTTLKAAIVSTSPQQQQQQPQKKHPPLEHPLSAGAAAGTGSSTGAAVQS 1018
              |....|:..:.|.........:...|..||..|||:  ..|:|.    |.:.|.:.|...|:|
  Rat   868 --VAEYITTERTDEGTEVAFPLLVSHRSQPQQPSQPQR--TLLQHV----AQSQTATQTSVVVKS 924

  Fly  1019  1018
              Rat   925  924

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15356NP_608633.1 ENT 16..82 CDD:281696 37/80 (46%)
EmsyXP_006229864.1 ENT 19..81 CDD:281696 37/62 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C365154861
eggNOG 1 0.900 E1_KOG4675
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006699
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_133870
Panther 1 1.100 LDO PTHR16500
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
65.790

Return to query results.
Submit another query.