DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15356 and emsy

Sequence 1:NP_608633.1 Gene:CG15356 FlyBaseID:FBgn0031377 Length:1023 Species:Drosophila melanogaster
Sequence 2:XP_009303311.1 Gene:emsy ZFINID:ZDB-GENE-030131-7832 Length:1184 Species:Danio rerio

Alignment Length:1163 Identity:284/1164 (24%)
Similarity:443/1164 (38%) Gaps:307/1164 (26%)


  Fly     1 MWPQTLEMSRDECRGMLRRLELESYSHVVSVFRAQGALSETKAKLLEELRQQFHINQERHRAEVR 65
            :||..|::|||||:.:||:||||:|:.|:|..||||.|::.|.:||.||.:...|:.||||||||
Zfish    15 VWPTLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKDKKELLGELTRVLSISTERHRAEVR 79

  Fly    66 RAANDEQLCTIAENVCGPNTWQEWSREGRRLYPLLPRISPQTALSIVANDLAAKACEENAKLAAP 130
            ||.|||:|.|||.::.|||:..|||.|||||.||:||:.||||.:::||.:|.....:||.|..|
Zfish    80 RAVNDERLTTIAHHMSGPNSSSEWSIEGRRLVPLMPRLVPQTAFTVMANAVANATAHQNASLPLP 144

  Fly   131 AETA-----VHFG---------EALVEQASLMSLKYPRGARIQDTAMVIMAEP---FKVPDLPNE 178
            ||||     |.:.         .|....:|..::|.||.|......:|:.:..   .|.....:|
Zfish   145 AETANKEVVVCYSYTSTTSTPPSASAPSSSSAAVKSPRPASPASNVVVLPSGSTVYVKSVSCSDE 209

  Fly   179 VKKMTQKRKENDSGIDG---KPNKKRHMQQPHPQQPHLQASQQQQQSQQLNPNSSNPGMEEADPV 240
            .:|..::|:.:.|....   |...|..:..|.|:...|..|.        .|..||.....|:.:
Zfish   210 DEKPRKRRRTSSSSSSPVLLKEVPKVAVTAPGPKTITLPVSG--------GPKISNLMQSIANSL 266

  Fly   241 PPEKRMTARTLQQRYFYQQQMKHKQRLASKRNLANRLGSPSAQSGNPLGGR-----NMPSSGGDT 300
            ||.......|..:                          ||.|:.|....:     ..|||....
Zfish   267 PPHMSPVKITFTK--------------------------PSTQTTNTTTQKVIIVTTSPSSNFVP 305

  Fly   301 STAKRSAAPAKSGRRAQKQLQQQQKLQQHQQQKVLMQSQ------------------ETVPNHMV 347
            :...:|...|     |..:|.....|....|::.::.|.                  .:.|:  |
Zfish   306 NILSKSHNYA-----AVSKLVSSAALTASSQKQTMVISAGGSSVAPGPGPVAVTTVVSSTPS--V 363

  Fly   348 VQPHVEYVLDEALKTLAASNPPTPTSTVAPPYTILNEPRPLVTLKPLKTIKPMIYGPQSGMPSAE 412
            |...|......|:| :|::..|:|.:.:..|..||..|:....:.            ||..|.|.
Zfish   364 VMSTVAQAGSAAVK-VASTRLPSPKALIGSPSQILQIPKAQQAVL------------QSAAPKAL 415

  Fly   413 IGSPTTPGSRGFANSPIVFKEKL---QASPVQVATQGQGSPTKKFVAEERHADAMPSAATTPTPI 474
            .||.:|..|...|.:....|..:   |.|.|::.|| |..|:|  :..:..:.|:||:::.|..:
Zfish   416 QGSISTAQSTALAAAGPGAKPTIQIKQESGVKIITQ-QMQPSK--ILPKPSSAALPSSSSAPIMV 477

  Fly   475 STANLPLAPQIISVQKIPAPSMGGKLRAAVASPTSS----TNSTLLPPGAK--TTPKKFNILEGD 533
            .::|              ...|..||   |::||.|    |..|:.|.|.:  |:|      .|.
Zfish   478 VSSN--------------GAIMTTKL---VSTPTGSASTYTRPTVSPMGTRVATSP------AGA 519

  Fly   534 AKPKTLPSSAVRLLPYT-EPIGGPLSPLKDSRVTPLSSASTVNIIKNIPASSLNNTLITPLPSA- 596
            ...||...|.:.::|.. ..:||.:       :|....:.|...|..||.:|..|.::....:. 
Zfish   520 TYVKTTSGSIITVVPKALATLGGKI-------ITTSMVSGTTTKITTIPMTSKPNVIVVQKTTGK 577

  Fly   597 GTTMPANLFRAKVTPSIKGASGAAGGATVIGAAGATGIGGAGAGPQILGNIKLTSSSGGAATIKQ 661
            |||             |:|..|.....|::.|                         ||..|::.
Zfish   578 GTT-------------IQGLPGKNVVTTLLNA-------------------------GGEKTLQA 604

  Fly   662 VPSSALRNIKICSPNGKLFL-QPGKLPAGSIIHKFNNASSTAVSAAGGVVTTTTTTVSPTK---- 721
            :|.:....|....|..|:.: ||..|.|                   ||..:|||.:.|||    
Zfish   605 IPGAKPAIITASRPITKMIVTQPKSLGA-------------------GVQPSTTTKIIPTKIVYG 650

  Fly   722 -----------QP--------AREQRISIQKILQPATGSASSGSSSPTTTTTTISGLTSSAKQPG 767
                       :|        :.:.|..:.:.||....||.:.    ||:|.|      ||...|
Zfish   651 QQGKTQVLIKPKPMAFQTAVVSEQTRQLVSETLQQVNRSAENN----TTSTHT------SAAAAG 705

  Fly   768 LGNKPTTLTFATAGGGKNN-------LVFL------------------PA-----------SAAS 796
            |.|:..|.|:.......::       :|.|                  ||           ||.|
Zfish   706 LENRDDTHTYTEGSPVPSDSTHDAPPVVHLISSRGQEWAEQEVSVESSPALIYQELTAESQSATS 770

  Fly   797 GMRAL----------TLATKPKSNVLVIGASTSP----ASAASSPNPSGGTKPKANQLITEDTPI 847
            .::||          ....||:.:.:.:.....|    |....||.|||.:..::: ..||..||
Zfish   771 TIKALLELQQTSVKEKSEAKPRQHTIDLSQMAVPIPVSAEQRESPEPSGQSAAESD-AHTEFIPI 834

  Fly   848 DIINMPIIVADNGTAAELNQASVKNSPLVVFNATDWEMELDQAA--TKSASTTSKQALDDVIIEE 910
            ..::         .|||::.:|.........:|....:::..||  |:......|...:.|::||
Zfish   835 GKVS---------KAAEVSASSTPGQSASAVSAAPHVVKISTAAVTTQQVEAQVKPQQEQVLVEE 890

  Fly   911 DE---DAEEEARESSEQPSTMDLNNSIIELHPEDDSAIEYVDMDLEQPVEIESTSNISPETATTT 972
            .|   |..:.......:.|.....:.:.|......|:........|.|:.::..::.|..:|..|
Zfish   891 CELEGDTLDPQTGLFYRSSPQQQLSRVCEAASSSSSSSSSSSRRAEPPLTVKILTHRSSSSAPAT 955

  Fly   973 LKAAIVSTSPQ--QQQQQPQKKHPPLEH-------PLSAGAAAGTG-SSTGAAVQSAI 1020
            ..:|....:||  :.||.|...:.|..|       ||.|....|:. :|:||.||..|
Zfish   956 AASANTPHTPQLPRLQQAPTTHNRPNTHTQLSQPPPLQAHHPVGSSKTSSGAQVQQPI 1013

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15356NP_608633.1 ENT 16..82 CDD:281696 37/66 (56%)
emsyXP_009303311.1 ENT 30..96 CDD:281696 37/66 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C365154292
eggNOG 1 0.900 E1_KOG4675
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 180 1.000 Inparanoid score I3920
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006699
OrthoInspector 1 1.000 T1053912
orthoMCL 1 0.900 OOG5_133870
Panther 1 1.100 LDO PTHR16500
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5579
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.