DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15356 and Emsy

Sequence 1:NP_608633.1 Gene:CG15356 FlyBaseID:FBgn0031377 Length:1023 Species:Drosophila melanogaster
Sequence 2:XP_006507678.1 Gene:Emsy MGIID:1924203 Length:1329 Species:Mus musculus

Alignment Length:1144 Identity:288/1145 (25%)
Similarity:429/1145 (37%) Gaps:370/1145 (32%)


  Fly     1 MWPQTLEMSRDECRGMLRRLELESYSHVVSVFRAQGALSETKAKLLEELRQQFHINQERHRAEVR 65
            :||..|::|||||:.:||:||||:|:.|:|..||||.|::.|..||.||.:...|:.||||||||
Mouse     4 VWPTLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSISTERHRAEVR 68

  Fly    66 RAANDEQLCTIAE--------------NVCGPNTWQEWSREGRRLYPLLPRISPQTALSIVANDL 116
            ||.|||:|.|||.              ::.|||:..|||.|||||.||:||:.||||.::.||.:
Mouse    69 RAVNDERLTTIAHKMNLSLYLGERPSYSMSGPNSSSEWSIEGRRLVPLMPRLVPQTAFTVTANAV 133

  Fly   117 AAKACEENAKLAAPAETA-----VHFG---------EALVEQASLMSLKYPRGARIQDTAMVIMA 167
            |..|.:.||.|..|||||     |.:.         ...|...|:.::|.||.|....:.:|   
Mouse   134 ANAAVQHNASLPVPAETASKDVVVCYSYTSTTSTPTSTPVPSGSIATVKSPRPASPASSVVV--- 195

  Fly   168 EPFKVPDLPNEVKKMTQKRKENDSGIDGKPNKKRHMQQPHPQQPHLQASQQQQQSQQLNPNSSNP 232
                   ||:......:....:|.  |.||.|:|                      :.|.:||:|
Mouse   196 -------LPSGSTVYVKSVSCSDE--DEKPRKRR----------------------RTNSSSSSP 229

  Fly   233 GMEEADP---VPPEKRMTARTLQQRYFYQQQMKHKQRLAS-KRNLANRL-----------GSPSA 282
            .:.:..|   ||..|.:|.           .:....:::: .:::||.|           ..||.
Mouse   230 VVLKEVPKAVVPVSKTITV-----------PVSGSPKMSNIMQSIANSLPPHMSPVKITFTKPST 283

  Fly   283 QSGNPLGGRNMPSSGGDTSTAKRSAAPAKSGRRAQKQLQQQQKLQQHQQQKVLM----QSQETVP 343
            |:.|             |:|                             |||::    .|...||
Mouse   284 QTTN-------------TTT-----------------------------QKVIIVTTSPSSTFVP 306

  Fly   344 NHMVVQPHVEYVLDEALKTLAASNPPTPTSTVA-----PPYTILNEPRPLVTLKPLKTIKPMIYG 403
            |          :|.:: ...||.....|||.:|     ||..|......|||             
Mouse   307 N----------ILSKS-HNYAAVTKLVPTSVIASTTQKPPVVITASQASLVT------------- 347

  Fly   404 PQSGMPSAEIGSPTTPGSRGFANSPIVFKEKLQASP-VQVATQGQGSPTKKFVAEERHADAMPSA 467
            ..|...|:...||        .:|.:.....:.::| |.::|..||..|...........:..|.
Mouse   348 SSSNGNSSSTSSP--------ISSTVAVTTVVSSTPSVVMSTVAQGVSTSAIKVASTRLPSPKSL 404

  Fly   468 ATTPTPISTANLPLAPQIISVQKIPAPSMGGKLRAAVASPTS-----STNSTLLPPGAKTT---- 523
            .:.||.| .|..|...|....|::  ..:..:.:..||.|:|     ....:.||||.|.|    
Mouse   405 VSGPTQI-LAQFPKQHQQSPKQQL--QQVQQQTQQPVAQPSSVSQQQQPQQSALPPGIKPTIQIK 466

  Fly   524 -PKKFNILEGDAKPKTLPSSAVRLLPYTEPIGGPLSPLKDSRVTPLSSASTVNIIKNIPASSLNN 587
             .....|:....:|.       ::||  :|:...|         |.||.|.:.::     ||...
Mouse   467 QESGVKIITQQVQPS-------KILP--KPVTATL---------PTSSNSPIMVV-----SSNGA 508

  Fly   588 TLITPLPSAGTTMPANLFRAKVTPSIKGASGAAGGATVIGAAGATGIGGAGAGPQILGNIKLTSS 652
            .:.|.|.:..|...|...|..|:||:...:...|.||.                     :|.||.
Mouse   509 IMTTKLVTTPTGTQATYTRPTVSPSLGRVATTPGAATY---------------------VKTTSG 552

  Fly   653 SGGAATIKQVPSSALRNIKICSPNGKLFLQPGKLPAGSIIHKFNNASSTAVSAAGGVVTTTTTTV 717
            |    .|..||.|      :.:..||:.                  ||..||.    .||..||:
Mouse   553 S----IITVVPKS------LATLGGKII------------------SSNIVSG----TTTKITTI 585

  Fly   718 SPTKQPAREQRISIQKILQPATGSASSGSSSPTTTTTTISGLTSSAKQPGLGNKPTTLTFATAGG 782
            ..|.:|   ..|.:||    .||..           |||.||      || .|..|||..|   |
Mouse   586 PMTSKP---NVIVVQK----TTGKG-----------TTIQGL------PG-KNVVTTLLNA---G 622

  Fly   783 GKNNLVFLPASAASGMRALTLATKPKSNVLV-----IGASTSPASAASSP-----NPSGGT---- 833
            |:..|..:||.|..   |:..||:|.:.::|     ||::..|| |...|     ...|.|    
Mouse   623 GEKTLQTVPAGAKP---AIITATRPITKMIVTQPKGIGSAVQPA-AKIIPTKIVYGQQGKTQVLI 683

  Fly   834 KPK------------ANQLITEDTPIDIINMPIIVAD-------------------NGTAAELNQ 867
            |||            ..||:||     .:.....|||                   :.::.|.:|
Mouse   684 KPKPVTFQATVVSEQTRQLVTE-----TLQQASRVADASNSSAQEGKEEPQGYTDSSSSSTESSQ 743

  Fly   868 ASVKNSPLVVFNAT---DW---EMELDQAAT---KSASTTSKQALDDV--IIEEDEDAEEEARES 921
            :|..:.|:|...|:   ||   |:.::.:.|   :..|:.|:.|...:  ::|..:...:|..||
Mouse   744 SSQDSQPVVHVIASRRQDWSEHEIAMETSPTIIYQDVSSESQSATSTIKALLELQQTTVKEKLES 808

  Fly   922 SEQPSTMDLNNSIIEL-------HPEDDSAIEYVDMDLEQPVEIESTSNISPETATTTLKAAIVS 979
            ..:..|:||:...:.:       |..:..:|..|:.:|   |....|:..:.|.........:..
Mouse   809 KPRQPTIDLSQMAVPIQMTQEKRHSPESPSIAVVESEL---VAEYITTERTDEGTEVAFPLLVSH 870

  Fly   980 TSPQQQQQQPQKKHPPLEHPLSAGAAAGTGSSTGAAVQS 1018
            .|..||..|||:  ..|:|.    |.:.|.:.|...|:|
Mouse   871 RSQPQQPSQPQR--TLLQHV----AQSQTATQTSVVVKS 903

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15356NP_608633.1 ENT 16..82 CDD:281696 37/80 (46%)
EmsyXP_006507678.1 ENT 19..81 CDD:281696 37/62 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C365151229
eggNOG 1 0.900 E1_KOG4675
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 150 1.000 Inparanoid score I4339
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006699
OrthoInspector 1 1.000 T1084737
orthoMCL 1 0.900 OOG5_133870
Panther 1 1.100 LDO PTHR16500
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5579
TreeFam 1 0.960
98.870

Return to query results.
Submit another query.