DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15356 and emsy

Sequence 1:NP_608633.1 Gene:CG15356 FlyBaseID:FBgn0031377 Length:1023 Species:Drosophila melanogaster
Sequence 2:XP_004912274.1 Gene:emsy XenbaseID:XB-GENE-6257795 Length:1341 Species:Xenopus tropicalis

Alignment Length:1130 Identity:287/1131 (25%)
Similarity:429/1131 (38%) Gaps:345/1131 (31%)


  Fly     1 MWPQTLEMSRDECRGMLRRLELESYSHVVSVFRAQGALSETKAKLLEELRQQFHINQERHRAEVR 65
            :||..|:.|||||:.:||:||||:|:.|:|..||||.|.:.|..||.||.:...|:.||||||||
 Frog    21 VWPTLLDFSRDECKRILRKLELEAYAGVISALRAQGDLCKEKKDLLGELSKVLSISTERHRAEVR 85

  Fly    66 RAANDEQLCTIAENVCGPNTWQEWSREGRRLYPLLPRISPQTALSIVANDLAAKACEENAKLAAP 130
            ||.|||:|.|||.|:.|||:..|||.|||||.||:||:.||||.:..||.:|..|.:.||.|..|
 Frog    86 RAVNDERLTTIAHNMSGPNSSSEWSIEGRRLVPLMPRLVPQTAFTATANAVANAAGQHNASLPDP 150

  Fly   131 AET-----AVHFG---------EALVEQASLMSLKYPRGARIQDTAMVIMAEPFKVPDLPN---- 177
            |||     .|.:.         ...|...|:.::|.||.|......:|          ||:    
 Frog   151 AETGNKEVVVCYSYTSTTSTPTSTPVPSGSVATVKSPRPASPASNVVV----------LPSGSTV 205

  Fly   178 EVKKMTQKRKENDSGIDGKPNKKRHMQQPHPQQPHLQASQQQQQSQQLNPNSSNPGMEEADPVPP 242
            .||.:      |.|..|.||.|:|                      :.|.|||:|.:.:..|.|.
 Frog   206 YVKSV------NCSDDDEKPRKRR----------------------RTNSNSSSPVVLKEVPKPT 242

  Fly   243 EKRMTARTLQQRYFYQQQMKHKQRLASKRNLANRL-----------GSPSAQSGNPLGGRNMPSS 296
            ..  .::|:........:|.:     ..:::||.|           ..|:.|:.|          
 Frog   243 TP--VSKTITVPVTGSPKMSN-----IMQSIANSLPPHMSPVKITFTKPATQTTN---------- 290

  Fly   297 GGDTSTAKRSAAPAKSGRRAQKQLQQQQKLQQHQQQKVLM----QSQETVPNHMVVQPHVEYVLD 357
               |||                             |||::    .|...|||          :|.
 Frog   291 ---TST-----------------------------QKVIIVTTSPSSTFVPN----------ILS 313

  Fly   358 EALKTLAASNPPTPTSTVAPPYTILNEPRPLVTLKPLKTIKPMIYGPQSGMPSAEIGSPTTPGSR 422
            :: ...||.....|||.:    |...:.:|||           :...||   |....|.|:..|.
 Frog   314 KS-HNYAAVTKLVPTSVI----TSATQKQPLV-----------VTASQS---SVVTSSSTSSSSP 359

  Fly   423 GFANSPIVFKEKLQASP-VQVATQGQGSPTKKFVAEERHADAMPSAATTPTPISTANLPLAPQII 486
            ...:..|.....:.::| :.::|...|:.|....|......:..|..|:|:.| .|.||...|..
 Frog   360 PLTSGSIAVTTVVSSTPSLVMSTVAPGASTSAVKAATNRLPSPKSLVTSPSQI-LAQLPKQYQQS 423

  Fly   487 ---SVQKIPAPSMGGKLRAAVASPTSSTNSTLLPPGAKTTPKKFNILEGDAKP--KTLPSSAVRL 546
               .:..||..:.......|:.:|.:.|:    ||.|:..|     :....||  :....|.|::
 Frog   424 PKHQIHTIPQQTQQLAQATAITNPGTITH----PPTAQQPP-----MPAAMKPTIQIKQESGVKI 479

  Fly   547 LPYTEPIGGPLSPLKDSRVTPLSSASTVNIIKNIP--ASSLNNTLITPLPSAGTTMPANLFRAKV 609
            :  |:.:       :.|::.|...::::....|.|  ..|.|..::|   :...|.|:.......
 Frog   480 I--TQQV-------QPSKILPKPVSTSLPNSSNAPIMVVSSNGAIMT---TKLVTTPSGTQATYT 532

  Fly   610 TPSIKGASGAAGGATVIGAAGATGIGGAGAGPQILGNIKLTSSSGGAATIKQVPSSALRNIKICS 674
            .|:|..|.||...||    .|||             .:|.||.|    .|..||.|      :.:
 Frog   533 RPTISSALGARMAAT----PGAT-------------YVKTTSGS----IITVVPKS------LAT 570

  Fly   675 PNGKLFLQPGKLPAGSIIHKFNNASSTAVSAAGGVVTTTTTTVSPTKQPAREQRISIQKILQPAT 739
            ..||:.                  ||..||.    .||..||:..|.:|   ..|.:||    .|
 Frog   571 LGGKII------------------SSNIVSG----TTTKITTIPMTSKP---NVIVVQK----TT 606

  Fly   740 GSASSGSSSPTTTTTTISGLTSSAKQPGLGNKPTTLTFATAGGGKNNLVFLPASAASGMRALTLA 804
            |..           |||.||      ||   |....|...|||.|.    |.|..|....|:..|
 Frog   607 GKG-----------TTIQGL------PG---KNVVTTLLNAGGDKT----LQAMPAGTKPAIITA 647

  Fly   805 TKPKSNVLVIGASTSPASAASSPNPS-------------GGT----KPK------------ANQL 840
            |:|.:.::|    |.|....|:..|:             |.|    |||            ..||
 Frog   648 TRPITKMIV----TQPKGMGSTVQPATKIIPTKIVYGQQGKTQVLIKPKPVTFQATVMSEQTRQL 708

  Fly   841 ITED----------TPIDIINMPIIVADNGTAAELNQASVKNSPLV---VFNATDW---EMELDQ 889
            :||.          |...|..:......:.::.|.:|:|..:.|:|   ...:.||   |:.:|.
 Frog   709 VTETLQQASRVVEATSATIQEVKEDTESSSSSTESSQSSQDSQPVVHVIASRSQDWAEHEIAMDT 773

  Fly   890 AAT----------KSASTTSKQALDDVIIEEDEDAEEEARESSEQPSTMDLNNSIIELHPEDD-- 942
            ..|          :||::|.|     .::|..:.|.:|..|:..:..|:||:...:.:....|  
 Frog   774 TPTIIYQDIGGESQSATSTIK-----ALMELQQTAVKEKVENKLRQPTIDLSQMAVPIQMAADKR 833

  Fly   943 ----SAIEYVDMDLEQPV------EIESTSNISPETATTTLKAAIVSTSPQQQQQQPQKKHPPLE 997
                |:|..|:.:|....      ::.||:.:|  :....|.:.:..:.|.||.||.|.....|:
 Frog   834 HAEGSSIAMVESELVAEYLSTGKRQMASTNTVS--SGDMPLPSLLQVSHPSQQLQQVQPTRTLLQ 896

  Fly   998 HPLSAGAAAGTG--------SSTGA 1014
            |...:..|:...        ||:||
 Frog   897 HVSQSQTASQASVVVKSIPTSSSGA 921

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15356NP_608633.1 ENT 16..82 CDD:281696 38/66 (58%)
emsyXP_004912274.1 ENT 36..102 CDD:281696 38/66 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C365155854
eggNOG 1 0.900 E1_KOG4675
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006699
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.790

Return to query results.
Submit another query.