DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAJB1 and CG5001

Sequence 1:NP_006136.1 Gene:DNAJB1 HGNCID:5270 Length:340 Species:Homo sapiens
Sequence 2:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster

Alignment Length:355 Identity:179/356 (50%)
Similarity:241/356 (68%) Gaps:22/356 (6%)


Human     1 MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFD 65
            ||||||:.|||.:.|:|:|||:|||:.||||||||||...||:||||:||||:||||..|||::|
  Fly     1 MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYD 65

Human    66 RYGEEGLKGSGPSGGS-GGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNG---EEGMD 126
            :|||:|||    |||: .||.:..||:|.|||||.|.||:|||..|||.:||...:.   ::..|
  Fly    66 KYGEDGLK----SGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFD 126

Human   127 ID-------DPFSGFPM--GMG-GFTNVNFGRSRSAQEPARK--KQDPPVTHDLRVSLEEIYSGC 179
            :|       .||.|...  |:| ||.......|.:...|.:|  ||||||.|||.|:|||||.||
  Fly   127 LDTEPDFFSSPFGGIGSRHGLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGC 191

Human   180 TKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPH 244
            .||||||.:.:..||.| |.|:|.|.|.:|.|||.|||:||.|||||....|||||||:::||||
  Fly   192 VKKMKISRRIVQADGSS-RKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFIIRDKPH 255

Human   245 NIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPV-VFKDVIRPGMRRKVPGEGLPLPKTP 308
            .:|||:|||:.|.||::|::||||....|||:.|..:.: ..:::|:|...:::.|.|||.||..
  Fly   256 AMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEIIKPNTVKRIQGYGLPFPKDT 320

Human   309 EKRGDLIIEFEVIFPERIPQTSRTVLEQVL 338
            .::|||::.|::.|||::....:.||:.:|
  Fly   321 TRKGDLLVAFDIQFPEKLTAAQKEVLKDML 350

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAJB1NP_006136.1 DnaJ 1..340 CDD:223560 179/356 (50%)
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 178/351 (51%)
DnaJ 4..65 CDD:278647 41/61 (67%)
DnaJ_C 174..338 CDD:199909 86/165 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116604476
eggNOG 1 0.900 E1_COG0484
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 371 1.000 Inparanoid score I2100
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1393097at2759
OrthoFinder 1 1.000 FOG0000281
OrthoInspector 1 1.000 T130177
orthoMCL 1 0.900 OOG5_126773
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1020
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.700

Return to query results.
Submit another query.