DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31663 and Mfsd6

DIOPT Version :8

Sequence 1:NP_001259884.1 Gene:CG31663 / 33363 FlyBaseID:FBgn0051663 Length:966 Species:Drosophila melanogaster
Sequence 2:NP_001100381.1 Gene:Mfsd6 / 301388 RGDID:1562317 Length:794 Species:Rattus norvegicus

Alignment Length:918 Identity:185/918 - (20%)
Similarity:326/918 - (35%) Gaps:278/918 - (30%)


  Fly    10 ATDPVVSEKVELSRFGEFCQRRGINPNLIMLKITLFVMYGATSSLLPYLTIHMQSIGLTVEEIAI 74
            :|:.....:.|:....:.|.:  ||.:|::.|:..|..|.|..||.|.|.::.:.:|::..:..:
  Rat    44 STETSAIPEEEIDWIEKHCVK--INNDLLISKVFYFFFYSAYGSLYPLLPVYYKQLGMSPSQSGL 106

  Fly    75 IYLALPFTTFLSPPITGFLVDKFGKYKPVVVMSLLLNAIFHHSLLFIPQQE---IPGVVPSAFVL 136
            :.....|..|.|.|..|.:.|:|.|.|.|::.|||...:|:..:.|:....   ||.:.|:|   
  Rat   107 LVGIRYFIEFCSAPFWGVVADRFKKGKIVLLFSLLCWVLFNLGIGFVKPATLRCIPKIPPTA--- 168

  Fly   137 RHPDSGDIEVWWSPCPSRECPEEPELELAVHQCVDYCLMQEQVNPQLYTNTPAYDVRPAATTSTT 201
             ||                                             ||               
  Rat   169 -HP---------------------------------------------TN--------------- 172

  Fly   202 QRSQLTATTARTTTMEPSSESSSSPAPTTSTTTSPASSLPALFATQTRSRYQEVLNMSSTMFPPM 266
                    .:...|:.|.:                 ||..|.|.|..:|..:..|..|:|     
  Rat   173 --------VSHPVTILPMN-----------------SSTVAFFTTPPKSLEKRSLLFSAT----- 207

  Fly   267 SQLKDALEEGVEPGQSSSAELSAMSMQGLNLTNSSQKKLLWSSWVHSDNDDATYFMLQMHPDLAD 331
                       ||                   |.|...||           :|...|...|.|..
  Rat   208 -----------EP-------------------NISNIDLL-----------STALTLTTEPTLRP 231

  Fly   332 PTEQLGMEIEQDANETVTDILQRFGHDYLVRGNINLTDMDDLDLRCGGLVRRTNMTNIASGAVEC 396
            .||.:        ...|||::       |....:.|..       .|.:.|.|.:..:.:     
  Rat   232 QTEGI--------THHVTDLI-------LNTSTVTLPP-------TGNVTRETTIAVVTT----- 269

  Fly   397 MMQRCTFTLNAPEICPPDYKETDEIIFWVYFLLRFLATTMLSAGVTIMDPIALTMIEKYGGDFGR 461
                 |.:|.:.::.....::..|.||.|..::..:.....::.|||:|.:.|..:.|:...:|.
  Rat   270 -----TKSLPSDQVTLVYDQQEVEAIFLVILVVVIIGEFFSASSVTIVDTVTLQYLGKHRDRYGL 329

  Fly   462 ERLFSSIGMAIFSPITGIMIDYSS-----RGLG-----YTDYSAAFYTYDVLLVISTMSVLMMP- 515
            :|::.|:|..:.....||.|||:.     .|.|     |.:|...|..:.||:   ||::::.. 
  Rat   330 QRMWGSLGWGLAMLSVGIGIDYTHIDVLIDGKGCKPPEYRNYQIVFIVFGVLM---TMALIVATQ 391

  Fly   516 -------------LGEKLPADNVFRD--------------------LWNLLKMPHVIAFICFLFV 547
                         .|:::....|.||                    .|:|:|:...:.:...|||
  Rat   392 FRFRYNHFNNSDGKGKEMEIPQVERDNSTESSEETPTAATHSQAFNFWDLIKLLCSVQYGSVLFV 456

  Fly   548 ---LGNFWGFIESFLFLYLKELGAPNYLLGITITVGTVSSIPFLYGAEKITRIFGHVNLIIIAFF 609
               :|..:||:.:||:.:|::|.....|.|:...:..||.:...:.:.|:..:.||:.::.|...
  Rat   457 AWFMGFGYGFVFTFLYWHLEDLNGTTTLFGVCSVLSHVSELTAYFFSHKLIELIGHIRVLYIGLA 521

  Fly   610 SHAGRLVGYSFIETAWWCFPFEAMESLSCHLMWVAAATYCSILAPKSLLATLIGVLGMAHFSLGR 674
            .:..|.:..|::|.||...|.|.::.::...:|.|..:|.|...|..|..:..|:|...|..|||
  Rat   522 CNTARYIYISYLENAWTVLPMEVLQGVTHAAIWAACISYLSAAVPPELRTSAQGILQGLHLGLGR 586

  Fly   675 GSGSFTGGLLIGQFGTRDAFRYMGLLAVVGGIAYGLLHLIWL----------------------- 716
            |.|:..||:|:..||....||.:|:..:|..:.:.|:.  ||                       
  Rat   587 GCGAMIGGVLVNYFGAAATFRGIGMACLVILLLFALIQ--WLAVPDEEEDKTMLAERIPVPSSPV 649

  Fly   717 --RKFDHTTEESEEEVEAVEA----------GETEKLTEPATKEQGTSMSLERLSLMIKYNQIGS 769
              ...|...:::|:.:..:||          .|.|.:.:||   .|.|.| ..::.:....|:..
  Rat   650 PIATIDLVQQQTEDVMPHIEARLPPKKTKHQEEQEDVNKPA---WGVSSS-PWVTFVYALYQVKE 710

  Fly   770 LSSLPRGSRADIHDHLSVRRSSYNVESLRGVPRHGNIGSASKVDILRSALEINHKSSNNSMLSKA 834
            |..|.|.|||.            .::.|:|:..:..:..|...   :.|....|..|..:.||..
  Rat   711 LMRLTRDSRAS------------EIQPLQGIHENRQVSPAGGA---QCAPHETHSDSPRNQLSPD 760

  Fly   835 DNKTSNQS 842
            ...:..||
  Rat   761 TAASQMQS 768

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31663NP_001259884.1 MFS_1_like 36..111 CDD:289593 23/74 (31%)
MFS <423..711 CDD:119392 81/334 (24%)
MFS_1 <423..678 CDD:284993 71/301 (24%)
Mfsd6NP_001100381.1 MFS_1_like 68..143 CDD:289593 23/74 (31%)
MFS_1 <77..169 CDD:284993 27/95 (28%)
TMIE 366..>395 CDD:292657 7/31 (23%)
MFS_1 453..>651 CDD:284993 51/199 (26%)
MFS 453..>623 CDD:119392 48/169 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3762
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR16172
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.