DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31663 and Mfsd6l

DIOPT Version :8

Sequence 1:NP_001259884.1 Gene:CG31663 / 33363 FlyBaseID:FBgn0051663 Length:966 Species:Drosophila melanogaster
Sequence 2:NP_001099257.1 Gene:Mfsd6l / 287414 RGDID:1307767 Length:596 Species:Rattus norvegicus

Alignment Length:695 Identity:132/695 - (18%)
Similarity:243/695 - (34%) Gaps:212/695 - (30%)


  Fly    56 PYLTIHMQSIGLTVEEIAIIYLALPFTTFLSPPITGFLVDKFGKYKPVVVMSLLLNAIFHHSLLF 120
            |:||::::.:|:....:.|:............|...||..::.|.:..:..|||.:|  ..|||.
  Rat    32 PFLTLYLRQLGVAAPWVGILMGTKHLIAACWTPFCAFLARRYQKRRMFLTGSLLGSA--GASLLM 94

  Fly   121 IPQQEIPGVVPSAFVLRHPDSGDIEVWWSPCPSRECPEEPELELAVHQCVDYCLMQEQVNPQLYT 185
            :       :||.|                           :..|..|.|                
  Rat    95 V-------LVPPA---------------------------DRNLGNHFC---------------- 109

  Fly   186 NTPAYDVRPAATTSTTQRSQLTATTARTTTMEPSSESSSSPAPTTSTTTSPASSLPALFATQTRS 250
                   ..::..:||....:...|...|:.:.|..:..:.||          |||.       |
  Rat   110 -------NGSSKVATTVLPLVVTQTVTMTSAQGSVPNHWAGAP----------SLPG-------S 150

  Fly   251 RYQEVLNMSSTMFPPMS-QLKDALEEGVEPGQSSSAELSAMSMQGLNLTNS-----SQKKLLWSS 309
            |:...|:.|.  ||..| :.::....|::.....|.|....:.|.|||..|     |||..    
  Rat   151 RHTRALDTSG--FPNGSGKTQERTLRGLQTYLVGSVEGVRTTAQALNLVTSGLRENSQKGT---- 209

  Fly   310 WVHSDNDDATYFMLQMHPDLADPTEQLGMEIEQDANETVTDILQRFGHDYLVRGNINLTDMDDLD 374
               |:..:|...:|.....|..|.         :.::|..||..   |::.::|           
  Rat   210 ---SEVSNANLSLLPGSTTLGGPV---------NVSKTQGDIQT---HNHTLKG----------- 248

  Fly   375 LRCGGLVRRTNMTNIASGAVECMMQRCTFTLNAPEICPPDYKETDEIIF---------------W 424
                     :..|.|.|..         |.:....:..|..:..|:.::               |
  Rat   249 ---------SQWTVILSFG---------FLVFWELLAAPLEQVADDSLYEYLDFVDAADRNKDLW 295

  Fly   425 VYFLLRFLATTMLSAGVTIMDPIALTMIEKYGGDFGRERLFSSIGMAIFSPITGIMIDYSSRGLG 489
            |:.||.      :||||.   .||                      |:...:...::....:|:.
  Rat   296 VWRLLG------ISAGVC---GIA----------------------ALVEHLECFLVANGPQGVI 329

  Fly   490 YTDYSAAFYTYDVL--LVISTMSVLMMPLGEK-------LPADNVFRDLWNLLKMPHVIAFICFL 545
            |      ||:|.::  |.::..:...:|:.::       :.|.::.||...|:    ::||.  :
  Rat   330 Y------FYSYSLVSTLALAVSTAFPVPIDQQQRPSYKAIKALSLVRDDSRLI----LLAFT--V 382

  Fly   546 FVLGNFWGFIESFLFLYLKELGAPNYLLGITITVGTVSSIPFLYGAEKITRIFGHVNLIIIAFFS 610
            |.:|.....:::|||.::|:.|:.:.::|.::.:|.:..|.|......:.|....|.::.:....
  Rat   383 FWIGATTSTVQNFLFWHMKDHGSSDLVMGFSVVLGLLGEILFHPFRTSLLRKLSRVGVLGLGLGC 447

  Fly   611 HAGRLVGYSFIETAWWCFPFEAMESLSCHLMWVAAATYCSILAPKSLLATLIGVLGMAH-FSLGR 674
            .|.:::.|:||.:.|...|.:.:.::|...:|.|.......|| .|.:...:..|...| :..|.
  Rat   448 LALQMLYYAFIWSWWSVLPVQILSAISSGALWWAVGASIGDLA-SSRMERSLNTLFRGHLYESGC 511

  Fly   675 GSGSFTGGLLIGQFGTRDAFRYMGLLAVVGGIAYGLLHLIWLRKF 719
            ..|||.||.:..:||.  |..|.....|:         |:||..|
  Rat   512 SLGSFVGGFVALRFGV--AVLYQACCVVL---------LLWLAVF 545

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31663NP_001259884.1 MFS_1_like 36..111 CDD:289593 12/54 (22%)
MFS <423..711 CDD:119392 62/312 (20%)
MFS_1 <423..678 CDD:284993 52/279 (19%)
Mfsd6lNP_001099257.1 MFS <28..87 CDD:304372 12/54 (22%)
MFS 375..>552 CDD:119392 45/189 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3762
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR16172
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.