DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31663 and Mfsd6l

DIOPT Version :8

Sequence 1:NP_001259884.1 Gene:CG31663 / 33363 FlyBaseID:FBgn0051663 Length:966 Species:Drosophila melanogaster
Sequence 2:NP_666116.1 Gene:Mfsd6l / 215723 MGIID:2384904 Length:586 Species:Mus musculus

Alignment Length:699 Identity:127/700 (18%)
Similarity:231/700 (33%) Gaps:230/700 (33%)


  Fly    56 PYLTIHMQSIGLTVEEIAIIYLALPFTTFLSPPITGFLVDKFGKYKPVVVMSLLLNAIFHHSLLF 120
            |:||::::.:|:....:.|:............|...||..::.|.:..:..|||.:|  ..|||.
Mouse    32 PFLTLYLRQLGVAAPLVGILMGTKHLIATCWIPFCAFLAKRYQKRRMFLTGSLLSSA--GASLLM 94

  Fly   121 IPQQEIPGVVPSAFVLRHPDSGDIEVWWSPCPSRECPEEPELELAVHQCVDYCLMQEQVNPQLYT 185
            :       :||..                           :..|..|    :|....:|      
Mouse    95 V-------LVPPV---------------------------DRNLVNH----FCNGSSRV------ 115

  Fly   186 NTPAYDVRPAATTSTTQRSQLTATTARTTTMEPSSESSSSPAPTTSTTTSPASSLPALFATQTRS 250
               |..:.|...|             :|..|.|             |..|.|.:||.       |
Mouse   116 ---ATTILPLGVT-------------QTVIMTP-------------TQGSGAPNLPG-------S 144

  Fly   251 RYQEVLNMSSTMFPPMSQLKDALEEGVEPGQSSSAELSAMSMQGLNLTNSSQKKLLWSSWVHSDN 315
            |:...|:.|.  ||..|   :....|::.....|.|.:..:.|||:|..|.              
Mouse   145 RHTRALDTSG--FPNGS---EGTFSGLQTYLVGSVEGARTTTQGLHLVTSG-------------- 190

  Fly   316 DDATYFMLQMHPDLADPTEQLGMEIEQDANETVTDILQRFGHDYLVRGNINLTDMDDLDLRCGGL 380
                         |.|.:::...|:                      ||:.|             
Mouse   191 -------------LRDNSQKGTFEV----------------------GNVTL------------- 207

  Fly   381 VRRTNMTNIASGAVECMMQRCTFTLNAP--------EICPPDYKETDEIIFWVYFLLRFLATTML 437
                   |:..|:.         .|..|        :...||:......  |         |.:|
Mouse   208 -------NLLPGST---------ALGGPVNLSKPQGDTQTPDHSSKGSP--W---------TFIL 245

  Fly   438 SAGVTIMDPIALTMIEKYGGD-----------FGRER-------LFSSIGMAIFSPITG----IM 480
            |.||.:...:....:|:...|           ..|.|       |..|.|:...:.:.|    ::
Mouse   246 SLGVVVFWELLAAPLEQVADDSLYEYLDFVDATDRNRDLWVWKLLGVSAGVCGIAALVGHLECLL 310

  Fly   481 IDYSSRGLGYTDYSAAFYTYDVL--LVISTMSVLMMPLGEKL-PADNVFRDLWNLLKMPHVIAFI 542
            :....:|:.|      ||:|.::  |.::..:...:|:.::. |:....:.| :|::....:..:
Mouse   311 VANGPQGVIY------FYSYSLVSTLALAVSTAFPVPIDQQQGPSYKAIKAL-SLIRGDSRLILL 368

  Fly   543 CF-LFVLGNFWGFIESFLFLYLKELGAPNYLLGITITVGTVSSIPFLYGAEKITRIFGHVNLIII 606
            .| :|.:|.....::.|||.::|:.|:...::|.::.:..:..|.|......:.|....|.::.:
Mouse   369 AFTVFWIGATASTVQDFLFWHMKDHGSSELVMGFSVALSLLGEILFHPFRTSLLRKLSRVGVLGL 433

  Fly   607 AFFSHAGRLVGYSFIETAWWCFPFEAMESLSCHLMWVAAATYCSILAPKSLLATLIGVLGMAHF- 670
            .....|.:::.|:||.:.|...|.:.:.::|...:|.|.......||...:..:| |.:...|| 
Mouse   434 GLGCLALQVLYYAFIWSWWSVLPVQILSTISSGALWWAVGASIEDLAFSGMERSL-GTMFRGHFY 497

  Fly   671 SLGRGSGSFTGGLLIGQFGTRDAFRYMGLLAVVGGIAYGLLHLIWLRKF 719
            ..|...|||.||.::..||.  |..|.....|:         |:||..|
Mouse   498 GSGCSLGSFVGGFVVLHFGI--AVLYEACCVVL---------LLWLALF 535

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31663NP_001259884.1 MFS_1_like 36..111 CDD:289593 12/55 (22%)
MFS <423..711 CDD:119392 63/315 (20%)
MFS_1 <423..678 CDD:284993 54/282 (19%)
Mfsd6lNP_666116.1 MFS <28..87 CDD:304372 12/55 (22%)
MFS 365..>521 CDD:119392 37/159 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3762
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR16172
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.