DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31663 and MFSD6L

DIOPT Version :8

Sequence 1:NP_001259884.1 Gene:CG31663 / 33363 FlyBaseID:FBgn0051663 Length:966 Species:Drosophila melanogaster
Sequence 2:NP_689812.3 Gene:MFSD6L / 162387 HGNCID:26656 Length:586 Species:Homo sapiens

Alignment Length:736 Identity:133/737 (18%)
Similarity:243/737 (33%) Gaps:236/737 (32%)


  Fly    56 PYLTIHMQSIGLTVEEIAIIYLALPFTTFLSPPITGFLVDKFGKYKPVVVMSLL--LNAIFHHSL 118
            |:||::::.:||....:..:............|:..||...:.|.:.:::.|||  :.|    ||
Human    32 PFLTLYLRQLGLAAPWVGTLMGTKHLIAAFWAPVCAFLAKSYRKRRALLIGSLLGSVGA----SL 92

  Fly   119 LFIPQQEIPGVVPSAFVLRHPDSGDIEVWWSPCPSRECPEEPELELAVHQCVDYCLMQEQVNPQL 183
            |.:       :||..      |...:..   ||..                              
Human    93 LMV-------LVPPV------DKNRVHF---PCNG------------------------------ 111

  Fly   184 YTNTPAYDVRPAATTSTTQRSQLTATTARTTTMEPSSESSSSPAPTTSTTTSPASSLPALFATQT 248
                      .:..|||.....:|.....|:..|   .:||.||..|:....|....|       
Human   112 ----------SSGLTSTDALPGVTLPVNITSAQE---SASSHPAKRTAEVEMPGFRNP------- 156

  Fly   249 RSRYQEVLNMSSTMFPPMSQLKDALEEGVEPGQSSSAELS------AMSMQGLNLTNSSQKKLLW 307
                                          ||:|......      |.|::|...|:.:....:.
Human   157 ------------------------------PGESDRETFRDLHVYLAPSVEGARTTSQALLHPVT 191

  Fly   308 SSWVHSDNDDATYFMLQMHPDLADPTEQLGMEIEQDANETVTDIL---QRFGHDYLVRGNINLTD 369
            |.             |:.||          .|:..:..:|...:|   :..|:...:.|......
Human   192 SG-------------LKDHP----------WEVTFEVVKTALPLLPGGKGPGNPANLSGTKGKAW 233

  Fly   370 MDDLDLRCGGLVRRTNMTNIASGAVECMMQRCTFTLNAP--EICPPDYKETDEII--------FW 424
            ..||.|..   :|||.:.::.|.|...:       |.||  ::......|..:.:        .|
Human   234 AFDLSLEA---LRRTFILSLGSVAFWEL-------LTAPLEQVADDSLYEFLDFVDATDRYRSLW 288

  Fly   425 VYFLLRFLATTMLSAGVTIMDPIALTMIEKYGGDFGRERLFSSIGMAIFSPITGIMIDYSSRGLG 489
            |:.||.      :||||     ..:|                    |:...:...::....||:.
Human   289 VWRLLG------MSAGV-----CGIT--------------------ALVGQLDCFLMTSGPRGVV 322

  Fly   490 YTDYSAAFYTYDVLLVISTMSVLMMPLGEKLPADNVFRDLWNLLKM-------PHVIAFICFLFV 547
            :      ||.|.   |:||:: |::.:...:|....:...:..:|.       ||:|.......:
Human   323 H------FYGYS---VVSTLA-LLVSIAFPIPICQQWEPSYKRVKALSIVGGDPHLILLASTTVL 377

  Fly   548 LGNFWGFIESFLFLYLKELGAPNYLLGITITVGTVSSI---PFLYGAEKITRIFGHVNLIIIAFF 609
            :|.....:::|||.::|:.|:...::|.::.:..:..|   ||   ...:.|......|:.:...
Human   378 VGAIVSTVQNFLFWHMKDHGSGELVMGFSVALSLLGEILLHPF---KATLLRKLSRTGLVGLGLS 439

  Fly   610 SHAGRLVGYSFIETAWWCFPFEAMESLSCH-LMWVAAATYCSILAPKSLLATLIGVLGMAHF-SL 672
            ..||:|:.|||:.:.|...|.:.:.::|.. |.|...|:...:..|:  :...:..|...|| ..
Human   440 CLAGQLLYYSFLWSWWSVLPIQILSAISNRALWWAVGASVEDLATPR--MERALSALFRGHFYGS 502

  Fly   673 GRGSGSFTGGLLIGQFGTRDAFRYMGLLAVVGGIAYGLLHLIWL-------RKFDHTTEESEEEV 730
            |...|||.||.::.:|..  |..|......:         |:||       |:.....:....::
Human   503 GCSLGSFVGGFVVMRFSL--AVLYQACCVAL---------LLWLALLLSIQRRLPRERKIKYSKL 556

  Fly   731 EAVEAGETEKLTEPATKEQGT 751
            .::|..:|      :..||||
Human   557 LSMEVSDT------SDSEQGT 571

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31663NP_001259884.1 MFS_1_like 36..111 CDD:289593 12/57 (21%)
MFS <423..711 CDD:119392 61/300 (20%)
MFS_1 <423..678 CDD:284993 54/267 (20%)
MFSD6LNP_689812.3 MFS <28..87 CDD:304372 12/55 (22%)
MFS 368..>529 CDD:119392 38/168 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3762
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR16172
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.