DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31663 and mfsd6l

DIOPT Version :8

Sequence 1:NP_001259884.1 Gene:CG31663 / 33363 FlyBaseID:FBgn0051663 Length:966 Species:Drosophila melanogaster
Sequence 2:XP_002937042.1 Gene:mfsd6l / 100379844 XenbaseID:XB-GENE-5841491 Length:611 Species:Xenopus tropicalis

Alignment Length:709 Identity:129/710 (18%)
Similarity:241/710 (34%) Gaps:221/710 (31%)


  Fly    54 LLPYLTIHMQSIGLTVEEIAIIYLALPFTTFLSPPITGFLVDKFGKYKPVVVMSLLLNAIFHHSL 118
            |:|:||::.:.:||....:.|:.........|..|:..||.....|.:..::.||||:|      
 Frog    30 LIPFLTLYFRQLGLAAPLVGIVIGFKHAVHLLWAPLCSFLAKSHRKRRFFIMASLLLSA------ 88

  Fly   119 LFIPQQEIPGVVPSAFVLRHPDSGDIEVWWSPCPSRECPEEPELELAVHQCVDYCLMQEQVNPQL 183
                                 .:|.:..::.|.         :..:|...|......:||.||.:
 Frog    89 ---------------------GAGGVFAFYPPL---------DKNIASMFCNTSMPWKEQFNPPV 123

  Fly   184 --------YTNT----PAYDVRPAATTSTTQRSQLT------ATTARTTTMEPSSE--SSSSPAP 228
                    |.||    |:.....|...:|.:..:||      .||.....:|.|:.  ||||||.
 Frog   124 GISVSVDEYFNTTYAAPSDHHTTAGAPTTLRDGELTTDISIDTTTTSPLDLETSAPPFSSSSPAT 188

  Fly   229 TTSTTTSPASSLPALFATQTRSRYQEVLNMSSTMFPPMSQLKDALEEGVEP--GQSSSAELSAMS 291
            :..|.......:|....|...:..:...:.|....||..:..   ..|..|  .|..||....:.
 Frog   189 SNKTLEHRTRKVPGSGKTHKANGTKASASNSKQKSPPSHRTS---ASGTHPNVSQHPSANRRKVR 250

  Fly   292 MQGLNLTNS---SQKK---------LLWS------SWVHSDNDDATYFMLQMHPDLADPTEQLGM 338
            ..||:..::   .:.|         ::|.      .|:   .||:.|..|    |..|.|::.|.
 Frog   251 DVGLDFADTFLDPEHKVFLIVLGLVIIWELVAAPLEWI---ADDSLYEYL----DFVDATDRHGK 308

  Fly   339 EIEQDANETVTDILQRFGHDYLVRGNINLTDMDDLDLRCGGLVRRTNMTNIASGAVECMMQRCTF 403
                         |..:|:.....|:|.:..:.|               |:          .|..
 Frog   309 -------------LWIWGYLGASMGSIFIAFLVD---------------NL----------NCFV 335

  Fly   404 TLNAPEICPPDYKETDEIIFWVY--FLLRFLATTMLSAGVTIMDPIALTMIEKYGGDFGRERLFS 466
            ..|.|.:         ...|:.|  ||   ::|..|||    :.||.::.               
 Frog   336 IFNIPRV---------SFHFFCYGGFL---VSTLFLSA----LYPIHVSK--------------- 369

  Fly   467 SIGMAIFSPITGIMIDYSSRGLGYTDYSAAFYTYDVLLVISTMSVLMMPLGEKLPADNVFRDLWN 531
                         ..::|::    |..:..|...|..:|::.::|                    
 Frog   370 -------------KTEHSNK----TVKALGFLGSDGRIVLTALTV-------------------- 397

  Fly   532 LLKMPHVIAFICFLFVLGNFWGFIESFLFLYLKELGAPNYLLGITITVGTVSSIPFLYGAEKITR 596
                          |:||......::|||..:::.|:....:|:::..|.::.:...:...||.:
 Frog   398 --------------FLLGAVGSTTQNFLFWQMQDAGSGELYMGLSVAAGLLAELTLYFFRNKILK 448

  Fly   597 IFGHVNLIIIAFFSHAGRLVGYSFIETAWWCFPFEAMESLSCHLMWVAA-ATYCSILAPKSLLAT 660
            :.....::::...|...:::.|||:...|.....:.:.:.|..::|.|. :....:.:|.:..:.
 Frog   449 VLTFKWMVVLGLLSLGVQVLYYSFLWAPWSVLAVQLLNAFSSGVIWWAINSQVVDVASPGTERSL 513

  Fly   661 LIGVLGMAHFSLGRGSGSFTGGLLIGQFGTRDAFRYMGLLAVVGGIAYGLLHLIWLRKF 719
            .:.:..:|:.| |..:|||..|.:|.:|.          |||:......|| |:|:..|
 Frog   514 QLALRWLAYGS-GASTGSFASGFVITRFS----------LAVLYQACCVLL-LLWIAVF 560

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31663NP_001259884.1 MFS_1_like 36..111 CDD:289593 16/57 (28%)
MFS <423..711 CDD:119392 49/291 (17%)
MFS_1 <423..678 CDD:284993 40/258 (16%)
mfsd6lXP_002937042.1 MFS 13..87 CDD:304372 16/57 (28%)
MFS 390..>567 CDD:119392 39/218 (18%)
MFS_1 393..>568 CDD:284993 38/215 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3762
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.