DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17646 and ABCG16

Sequence 1:NP_608618.1 Gene:CG17646 FlyBaseID:FBgn0264494 Length:766 Species:Drosophila melanogaster
Sequence 2:NP_191069.2 Gene:ABCG16 AraportID:AT3G55090 Length:736 Species:Arabidopsis thaliana

Alignment Length:746 Identity:185/747 (25%)
Similarity:314/747 (42%) Gaps:162/747 (22%)


  Fly   103 PVDIQFADVRYTV---KKFSF----PERK---FVTKEILHGLNGSFRSGELTAIMGPSGAGKSTL 157
            |..:.|.::.|.|   :|..|    |.|:   ..||.:|..::|..|.||:.|::|.||:|||||
plant    70 PFVLSFNNLTYNVSVRRKLDFHDLVPWRRTSFSKTKTLLDNISGETRDGEILAVLGASGSGKSTL 134

  Fly   158 LNVMSGFCSTG-VSGDIRVNRKPMAPSSERFRQMLCYIHQDDLLRPQLLVGEIMLLAAHLKLGFK 221
            ::.::...:.| :.|.:.:|.:  |..|...:.:..|:.|||||.|.|.|.|.::.||..:|...
plant   135 IDALANRIAKGSLKGTVTLNGE--ALQSRMLKVISAYVMQDDLLFPMLTVEETLMFAAEFRLPRS 197

  Fly   222 VTKAYKMDLIKHILSLLGLDHRYNVPTGK-----LSGGQKKRLAIALELISNPPVLYLDEPTTGL 281
            :.|:.|...::.::..||:.:......|.     :|||:::|::|.:::|.:|.||:|||||:||
plant   198 LPKSKKKLRVQALIDQLGIRNAAKTIIGDEGHRGISGGERRRVSIGIDIIHDPIVLFLDEPTSGL 262

  Fly   282 DSSSCSSCVALLKKLASQGHTIVCTIHQPSALIFEMFDKLYTVVDGHCMYQGPVRELVPFLADQQ 346
            ||:|....|.:||::|..|..|:.:|||||..:..:.|:|..:..||.::.|....|..|.|...
plant   263 DSTSAFMVVKVLKRIAESGSIIIMSIHQPSHRVLSLLDRLIFLSRGHTVFSGSPASLPSFFAGFG 327

  Fly   347 LVCPSYHNPADYLLEVAVGEHQRDLNELIHAA---------NKKYYEDVDRHRYMSSDDMARLVE 402
            ...|...|..::.|::        :.||..:|         |||:.|                  
plant   328 NPIPENENQTEFALDL--------IRELEGSAGGTRGLVEFNKKWQE------------------ 366

  Fly   403 SIKENMGGKAVVKTSEALAAFAAAQFSSFDYVKPSPQELALEEI--------KALSGGPESADPD 459
             :|:....:.:...:                 .|:| .|.|:|.        |.:|||  .....
plant   367 -MKKQSNPQTLTPPA-----------------SPNP-NLTLKEAISASISRGKLVSGG--GGGSS 410

  Fly   460 LLEKNLRPQPQPLAKAGELARPPNAIRSASFLMQYVLLMQRILICAKRNYFLLLARIFSHIFIGV 524
            ::...          .|.||.|..|   ..|.::...|.:|.::.::|...||..|:.:.|..|.
plant   411 VINHG----------GGTLAVPAFA---NPFWIEIKTLTRRSILNSRRQPELLGMRLATVIVTGF 462

  Fly   525 VFGYLYMNVGNNAQSV---LGNYVYLYGSTLLLVYTGKMAVVLTFPLEIDMLTREHFNRWYKLGP 586
            :...::..:.|:.:.|   ||.:.:.. ||:.......:.|.|.   |..:..||.....|:...
plant   463 ILATVFWRLDNSPKGVQERLGFFAFAM-STMFYTCADALPVFLQ---ERYIFMRETAYNAYRRSS 523

  Fly   587 YFLS--LISF-EIPFQSLCTAMYIIISVHLTGNDATDSFRIYYFMLLGIMASL-SAQAWGFFVGA 647
            |.||  :::| .:.|.||..|:....:|.|.|     ....:.|..|.|:||. |..::..|:..
plant   524 YVLSHAIVTFPSLIFLSLAFAVTTFWAVGLEG-----GLMGFLFYCLIILASFWSGSSFVTFLSG 583

  Fly   648 TLPTKLAVFLG-----PILA--VMFSVFGFCTRYIDITPLFRWMW--HLSYFRAGFHGAL----- 698
            .:|   .|.||     .|||  ::||.| |..|  |..|.: |:|  :||..:..:...|     
plant   584 VVP---HVMLGYTIVVAILAYFLLFSGF-FINR--DRIPQY-WIWFHYLSLVKYPYEAVLQNEFS 641

  Fly   699 -------------------NAIYGMDRPFLECPETAMYCHFRSPKVF------LKYMMISDVHMS 738
                               ...|||....|:....::.....|....      ||...::.:...
plant   642 DPTECFVRGVQLFDNSPLGELTYGMKLRLLDSVSRSIGMRISSSTCLTTGADVLKQQGVTQLSKW 706

  Fly   739 DCLIL---MGIVIGVMHVLTLITLWHKLNKR 766
            :||::   .|.:..::..|.|: |..| |||
plant   707 NCLLITVGFGFLFRILFYLCLL-LGSK-NKR 735

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17646NP_608618.1 ABCG_EPDR 103..333 CDD:213180 81/246 (33%)
3a01204 123..765 CDD:273361 176/717 (25%)
ABC2_membrane 497..698 CDD:279410 56/217 (26%)
ABCG16NP_191069.2 3a01204 75..735 CDD:273361 183/740 (25%)
P-loop_NTPase 85..314 CDD:304359 77/231 (33%)
ABC2_membrane 435..638 CDD:279410 57/219 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1022017at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19241
Phylome 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.