DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17646 and abcg4b

Sequence 1:NP_608618.1 Gene:CG17646 FlyBaseID:FBgn0264494 Length:766 Species:Drosophila melanogaster
Sequence 2:NP_001104682.1 Gene:abcg4b ZFINID:ZDB-GENE-080215-10 Length:644 Species:Danio rerio

Alignment Length:719 Identity:260/720 (36%)
Similarity:377/720 (52%) Gaps:103/720 (14%)


  Fly    65 TSSRGSCELTSKVTNDLNGFQSPNYHQAVAH-----------ANFDHC---DPVDIQFADVRYTV 115
            ||..||..:..: .:..||...|.....:.|           ..|.|.   ..|:::|.::.||:
Zfish     5 TSDPGSVSIGME-ESLCNGGSQPQEAPLLTHLKKVENHITEAQRFSHLPKRTTVELEFKELCYTI 68

  Fly   116 KKFSFPERKFVTKEILHGLNGSFRSGELTAIMGPSGAGKSTLLNVMSGFCSTGVSGDIRVNRKPM 180
            ::..: .:|...|.:|..|:|.|.|.||..||||||||||||:|:::|:..||::|.|.||.|..
Zfish    69 REGPW-WKKQGYKALLKCLSGKFSSRELIGIMGPSGAGKSTLMNILAGYRETGMTGQILVNGKLR 132

  Fly   181 APSSERFRQMLCYIHQDDLLRPQLLVGEIMLLAAHLKLGFKVTKAYKMDLIKHILSLLGLDHRYN 245
            .|.:  ||:|.|||.|:|.|.|.|.|.|.|:::|:|||  ..:...|.:|||.||:.|||....:
Zfish   133 DPRT--FRKMSCYIMQEDKLLPHLSVQEAMMVSANLKL--NESSEVKKELIKEILTALGLHECVH 193

  Fly   246 VPTGKLSGGQKKRLAIALELISNPPVLYLDEPTTGLDSSSCSSCVALLKKLASQGHTIVCTIHQP 310
            ..|..|||||.|||||||||::||||::.||||:||||:||...|:|:|.||..|.||:||||||
Zfish   194 TRTVSLSGGQCKRLAIALELVNNPPVMFFDEPTSGLDSASCFQVVSLMKSLAQGGRTIICTIHQP 258

  Fly   311 SALIFEMFDKLYTVVDGHCMYQGPVRELVPFLADQQLVCPSYHNPADYLLEVAVGEHQRDLNELI 375
            ||.:||||||||.:..|.|:|:|.|..|:|:|....|.||:||||||:::|||.||: .|||.: 
Zfish   259 SAKLFEMFDKLYILSQGQCIYKGSVPYLIPYLRGLGLHCPTYHNPADFIIEVASGEY-GDLNPV- 321

  Fly   376 HAANKKYYEDVDRHRYMSSDDMARLVESIKENMGGKAVVKTSEALAAFAAAQFSSFDYVKPSPQE 440
                                    |.|:::..|                                
Zfish   322 ------------------------LFEAVQGGM-------------------------------- 330

  Fly   441 LALEEIKALSGGPESADPDLLEKNLRPQPQPLAKAGELARPPNAIRSASF----LMQYVLLMQRI 501
            .||||                :.|...:....:.|.:..:.|..:.|.:|    |.|:.:|.:|.
Zfish   331 CALEE----------------KCNCIDKTTVTSCAAKCVKDPGHVESHTFATSSLTQFCILFKRT 379

  Fly   502 LICAKRNYFLLLARIFSHIFIGVVFGYLYMNVGNNAQSVLGNYVYLYGSTLLLVYTGKMAVVLTF 566
            .|...|:..|...|:.|||.|||:.|.||:|:||:|..|..|..:|:.|.|.|::...|..||||
Zfish   380 FITICRDQVLTHLRLMSHISIGVLIGLLYLNIGNDASKVFNNTGFLFFSMLFLMFGALMPTVLTF 444

  Fly   567 PLEIDMLTREHFNRWYKLGPYFLSLISFEIPFQSLCTAMYIIISVHLTGNDATDSFRIYYFMLLG 631
            |||:.:..|||.|.||.|..|:|:....:||||.||..||..|...:| ....::.|...|:.|.
Zfish   445 PLEMAVFLREHLNYWYSLKAYYLAKTMADIPFQVLCPIMYCSIVYWMT-EQPPEASRYLLFLALS 508

  Fly   632 IMASLSAQAWGFFVG-ATLPTKLAVFLGPILAVMFSVF-GFCTRYIDITPLFRWMWHLSYFRAGF 694
            |..:|.||:.|..|| |:...::|.|:||:..:...:| ||...:..|....:|..::||.|.||
Zfish   509 ICTALVAQSLGLLVGAASTSLQVATFVGPVTGIPVLLFSGFFVNFDTIPEYLQWSSYVSYVRYGF 573

  Fly   695 HGALNAIYGMDRPFLECPETAMYCHFRSPKVFLKYMMISDVHMSDCLILMGIVIGVMHVLTLITL 759
            ...:.:||||:|...|||  ...|.|:.|:..|:.:.:.|..:....|::||...::.:.|.:.|
Zfish   574 EEVILSIYGMNRTERECP--GRVCKFQRPEEVLQLLDVEDAKLYMDFIVLGIFFVILRLATYVVL 636

  Fly   760 WHKL 763
            .:|:
Zfish   637 RYKI 640

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17646NP_608618.1 ABCG_EPDR 103..333 CDD:213180 118/230 (51%)
3a01204 123..765 CDD:273361 246/648 (38%)
ABC2_membrane 497..698 CDD:279410 77/203 (38%)
abcg4bNP_001104682.1 3a01204 42..644 CDD:273361 252/682 (37%)
ABCG_EPDR 57..281 CDD:213180 118/229 (52%)
ABC2_membrane 375..574 CDD:279410 77/200 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1131
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D177791at33208
OrthoFinder 1 1.000 FOG0000096
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19241
Phylome 1 0.910 0.615 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.