DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17646 and bw

Sequence 1:NP_608618.1 Gene:CG17646 FlyBaseID:FBgn0264494 Length:766 Species:Drosophila melanogaster
Sequence 2:NP_001286769.1 Gene:bw FlyBaseID:FBgn0000241 Length:675 Species:Drosophila melanogaster

Alignment Length:749 Identity:164/750 (22%)
Similarity:286/750 (38%) Gaps:203/750 (27%)


  Fly   106 IQFADVRYTV-----KKFSFPE--RKFVTKEILHGLNGSFRSGELTAIMGPSGAGKSTLLNVMSG 163
            :::..:.|.|     ..:||..  ||.....||...:|..::|:|.||:|.|||||:|||..:|.
  Fly    17 LEWKQLNYYVPDQEQSNYSFWNECRKKRELRILQDASGHMKTGDLIAILGGSGAGKTTLLAAISQ 81

  Fly   164 FCSTGVSGDIRVNRKPMAPSSERFRQMLCYIHQDDLLRPQLLVGEIMLLAAHLKLGFKVTKAYKM 228
            .....::||:.:|  .||....:..::..::.|.::........|.:...:|.|:..:.|||.|.
  Fly    82 RLRGNLTGDVVLN--GMAMERHQMTRISSFLPQFEINVKTFTAYEHLYFMSHFKMHRRTTKAEKR 144

  Fly   229 DLIKHILSLLGLDHRYNVPTGKLSGGQKKRLAIALELISNPPVLYLDEPTTGLDSSSCSSCVALL 293
            ..:..:|..:||....:....:||||::|||::|.|||::|..|:.|||||||||.|..|.:..|
  Fly   145 QRVADLLLAVGLRDAAHTRIQQLSGGERKRLSLAEELITDPIFLFCDEPTTGLDSFSAYSVIKTL 209

  Fly   294 KKLASQ----GHTI--------------------------------------------------- 303
            :.|.::    .|::                                                   
  Fly   210 RHLCTRRRIAKHSLNQVYGEDSFETPSGESSASGSGSKSIEMEVVAESHESLLQTMRELPALGVL 274

  Fly   304 ------------VCTIHQPSALIFEMFDKLYTVVDGHCMYQGPVRELVPFLADQQLVCPSYHNPA 356
                        :|:||||::.|||:|..:..:..|..:|||...:...|..|.....|...|||
  Fly   275 SNSPNGTHKKAAICSIHQPTSDIFELFTHIILMDGGRIVYQGRTEQAAKFFTDLGYELPLNCNPA 339

  Fly   357 D-YLLEVAVGEHQRDLNELIHAANKKYYEDVDRHRYMSSDDMARLVESIKENMGGKAVVKTSEAL 420
            | ||..:|..|.:.:...::.|   ||..:.| ..|..|                          
  Fly   340 DFYLKTLADKEGKENAGAVLRA---KYEHETD-GLYSGS-------------------------- 374

  Fly   421 AAFAAAQFSSFDYVKPSPQELALEEIKALSGGPESADPDLLEKNLRPQPQPLAKAGELARPPNAI 485
              :..|:..|.||:|      .::..|.:                                    
  Fly   375 --WLLARSYSGDYLK------HVQNFKKI------------------------------------ 395

  Fly   486 RSASFLMQYVLLMQRILICAKRN---------YFLLLARIFSHIFIGVVFGYLYMNVGNNAQSV- 540
               .::.|..|||.|.:....||         :|::.|         |....:|..:|...|.. 
  Fly   396 ---RWIYQVYLLMVRFMTEDLRNIRSGLIAFGFFMITA---------VTLSLMYSGIGGLTQRTV 448

  Fly   541 --LGNYVYLYGSTLLLVYTGKMAVVLTFPLEIDMLTREHFNRWYKLGPYFLSLISFEIP---FQS 600
              :|..:::..:.  :::|....|...||..:.::.||.....|.|..|:::|:...:|   |:.
  Fly   449 QDVGGSIFMLSNE--MIFTFSYGVTYIFPAALPIIRREVGEGTYSLSAYYVALVLSFVPVAFFKG 511

  Fly   601 LCTAMYIIISVHLTGNDATDSFRIYYFMLLGIMASLSAQA---WGFFVGATLPT-KLAVFLGPIL 661
                 |:.:||.......|..|.:|  :.:|.:.||||.|   :|.|:.:...: |:|.......
  Fly   512 -----YVFLSVIYASIYYTRGFLLY--LSMGFLMSLSAVAAVGYGVFLSSLFESDKMASECAAPF 569

  Fly   662 AVMFSVFGFCTRYIDITPLFRWMWHLSYFRAGFHG--ALNAIYGMDRPFLECPETAMYCHFRSPK 724
            .::|.:||.....:|..|      .|.|....|:.  ||...:.:|...::||....:...::..
  Fly   570 DLIFLIFGGTYMNVDTVP------GLKYLSLFFYSNEALMYKFWIDIDNIDCPVNEDHPCIKTGV 628

  Fly   725 VFLK---YMMISDVHMSDCLILMGIVIGVMHVLT 755
            ..|:   |......:..||..|: :|..:.|:::
  Fly   629 EVLQQGSYRNADYTYWLDCFSLV-VVAVIFHIVS 661

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17646NP_608618.1 ABCG_EPDR 103..333 CDD:213180 78/301 (26%)
3a01204 123..765 CDD:273361 160/726 (22%)
ABC2_membrane 497..698 CDD:279410 49/222 (22%)
bwNP_001286769.1 P-loop_NTPase 31..316 CDD:304359 76/287 (26%)
3a01204 40..673 CDD:273361 160/727 (22%)
ABC2_membrane 404..604 CDD:279410 50/224 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1131
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1022017at2759
OrthoFinder 1 1.000 FOG0000096
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR19241
RoundUp 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.