DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17646 and CG9663

Sequence 1:NP_608618.1 Gene:CG17646 FlyBaseID:FBgn0264494 Length:766 Species:Drosophila melanogaster
Sequence 2:NP_608760.2 Gene:CG9663 FlyBaseID:FBgn0031516 Length:808 Species:Drosophila melanogaster

Alignment Length:785 Identity:268/786 (34%)
Similarity:401/786 (51%) Gaps:76/786 (10%)


  Fly     1 MTLLPDIKASDAACCVGGANSDASSSSGVCSLKGHHGDPDSGCLGINCCTTAASSELSIDETSST 65
            :||....|:.||. .....|:..|:|..|      :|.|    ||    .|..||..:..:.|..
  Fly    65 LTLNIKAKSHDAP-LAETENTVLSTSESV------YGTP----LG----ATPVSSPANQSQRSQA 114

  Fly    66 SSRGSCELTSKVTNDLNGFQSPNYHQAVAHANFDHCDPVDIQFADVRYTVKKFSFPERKFVTKEI 130
            |........:..|....|...|       |..:.....::|.|.::|||. ||...:|:  ||::
  Fly   115 SQHSDESRNTSSTATSGGSIFP-------HEQYKTIKKINIGFENIRYTT-KFGVFQRE--TKDV 169

  Fly   131 LHGLNGSFRSGELTAIMGPSGAGKSTLLNVMSGFCSTGVSGDIRV--NRKPMAPSSERFRQMLCY 193
            |.||.|.|:||||:|::||||||||||||::||:.:.|.:||.||  ||:.:    :.|:..:.:
  Fly   170 LMGLTGYFKSGELSAVIGPSGAGKSTLLNILSGYTTYGFTGDFRVNGNRRDL----KAFKSNVAF 230

  Fly   194 IHQDDLLRPQLLVGEIMLLAAHLKLGFKVTKAYKMDLIKHILSLLGLDHRYNVPTGKLSGGQKKR 258
            |.||..|:..|.|.|.|..||:||:|..:|.:.|.:.:|.||..:|:....:..||:||||||||
  Fly   231 IRQDTSLQAFLSVKEAMHFAANLKIGTHMTHSEKRERVKCILEAIGMYENRHTRTGQLSGGQKKR 295

  Fly   259 LAIALELISNPPVLYLDEPTTGLDSSSCSSCVALLKKLASQGHTIVCTIHQPSALIFEMFDKLYT 323
            |||||||::|||||.||||||||||.:.:..:.||||||.:|.|::|||||||||.|.|||.||.
  Fly   296 LAIALELVNNPPVLILDEPTTGLDSFTSNQLINLLKKLAIEGRTVICTIHQPSALTFAMFDHLYA 360

  Fly   324 VVDGHCMYQGPVRELVPFLADQQLVCPSYHNPADYLLEVAVGEH----QRDLNELIHAANKKYYE 384
            :.:|.|:|.|..:.|:|||....|.||..:||||||:|:|..::    ...|.:|:...:....|
  Fly   361 IGEGKCIYAGGAQNLLPFLGALNLHCPESYNPADYLMEIATHDYDTAEDNQLEKLVALMDNGRNE 425

  Fly   385 DVDRHRYMSSDDMARLVESIKENM---GGKAVVKTSEALAAFAAAQFSSFDYVKPSPQELALEEI 446
            |   :|...:..:|:|....|.:.   .|.....|:..::....|.|...:..||      |..|
  Fly   426 D---YRQSKTARVAQLAAMKKVDQLMAAGLITPVTAPVMSTSVPAHFMQGNTFKP------LTPI 481

  Fly   447 KALS-----------GGPESADPDLLEKNLRP----QPQPLAKAGELARPPNAIRSASFLMQYVL 496
            ..||           |...|......:...||    .|..|.|...:...|       |..|..:
  Fly   482 NELSSRVWDSQTAGIGNAGSCCKPKKKNKSRPAIELDPSHLCKRQNIYATP-------FYRQLSI 539

  Fly   497 LMQRILICAKRNYFLLLARIFSHIFIGVVFGYLYMNVGNNAQSVLGNYVYLYGSTLLLVYTGKMA 561
            |:.|..:...|:..|...|...|:..|::.|.||..:||:|...|..:.||:.:.:.::|.....
  Fly   540 LLVRTFLLIWRDSSLTTMRFAIHLITGILIGTLYFGIGNDAAQTLNIFRYLFYTIMFIMYCAFSG 604

  Fly   562 VVLTFPLEIDMLTREHFNRWYKLGPYFLSLISFEIPFQSLCTAMYIIISVHLTGNDATDSFRIYY 626
            :::.||||..:::||||||||.|..|::::...::|.|.:|:|:: |:..:|......:.:|...
  Fly   605 ILVKFPLEFPIVSREHFNRWYSLRAYYVAITLADLPIQIICSALF-IVPTYLMTQQPLELWRFGM 668

  Fly   627 FMLLGIMASLSAQAWGFFVGATLPTKLAVFLGPILAVMFSVF-GFCTRYIDITPLFRWMWHLSYF 690
            |.|:..:.:|.:|:.|..|||.|..||...|||.....|..| ||.....|.....|||:.:|:.
  Fly   669 FFLIVFVTALVSQSIGLAVGAALSLKLGSILGPFFICPFLQFSGFFLMEKDAPVFLRWMFDISFL 733

  Fly   691 RAGFHGALNAIYGMDRPFLECPETAMYCHFRSPKVFLKYMMISDVHMSDCLILMGIVIGVMHVLT 755
            :....||..||:|.||..|.|.|  :|||.|.|:..||.:.:::.:.:..||.:   .||:..|.
  Fly   734 KYSLEGATMAIFGYDREPLACNE--LYCHLRHPQFILKSLDMANGNYTLALIFL---FGVLVFLR 793

  Fly   756 LITLW 760
            ::..:
  Fly   794 ILAFY 798

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17646NP_608618.1 ABCG_EPDR 103..333 CDD:213180 119/232 (51%)
3a01204 123..765 CDD:273361 239/664 (36%)
ABC2_membrane 497..698 CDD:279410 63/202 (31%)
CG9663NP_608760.2 ABCG_EPDR 145..370 CDD:213180 119/232 (51%)
3a01204 149..808 CDD:273361 245/680 (36%)
ABC2_membrane 540..743 CDD:279410 63/204 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1131
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1022017at2759
OrthoFinder 1 1.000 FOG0000096
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR19241
RoundUp 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.