DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17646 and Abcg4

Sequence 1:NP_608618.1 Gene:CG17646 FlyBaseID:FBgn0264494 Length:766 Species:Drosophila melanogaster
Sequence 2:NP_001100286.1 Gene:Abcg4 RGDID:1305840 Length:650 Species:Rattus norvegicus

Alignment Length:738 Identity:257/739 (35%)
Similarity:372/739 (50%) Gaps:117/739 (16%)


  Fly    42 GC-LGINCCTTAASSELSIDETSSTSSRGSCELTSKVTNDLNGFQSPNYHQAVAHANFDHC---D 102
            || ||......|.:.|...:....|:.      ..||.|.:...|           .|.|.   .
  Rat    10 GCGLGPGAVAMAVALEDGAEPPVLTTH------LKKVENHITEAQ-----------RFSHLPKRS 57

  Fly   103 PVDIQFADVRYTVKKFSFPERKFVTKEILHGLNGSFRSGELTAIMGPSGAGKSTLLNVMSGFCST 167
            .|||:|.::.|:|::... .||...|.:|..|:|.|...||..|||||||||||.:|:::|:..:
  Rat    58 AVDIEFVELSYSVREGPC-WRKRGYKTLLKCLSGKFCRRELIGIMGPSGAGKSTFMNILAGYRES 121

  Fly   168 GVSGDIRVNRKPMAPSSERFRQMLCYIHQDDLLRPQLLVGEIMLLAAHLKLGFKVTKAYKMDLIK 232
            |:.|.|.||.:|.  ....||:|.|||.|||:|.|.|.|.|.|:::|:|||..|  :..|.:|:.
  Rat   122 GMKGQILVNGRPR--DLRTFRKMSCYIMQDDMLLPHLTVLEAMMVSANLKLSEK--QEVKKELVT 182

  Fly   233 HILSLLGLDHRYNVPTGKLSGGQKKRLAIALELISNPPVLYLDEPTTGLDSSSCSSCVALLKKLA 297
            .||:.|||....:..|..|||||:|||||||||::||||::.||||:||||:||...|:|:|.||
  Rat   183 EILTALGLMSCSHTRTALLSGGQRKRLAIALELVNNPPVMFFDEPTSGLDSASCFQVVSLMKSLA 247

  Fly   298 SQGHTIVCTIHQPSALIFEMFDKLYTVVDGHCMYQGPVRELVPFLADQQLVCPSYHNPADYLLEV 362
            ..|.|::||||||||.:||||||||.:..|.|:::|.|..|:|:|....|.||:||||||:::||
  Rat   248 HGGRTVICTIHQPSAKLFEMFDKLYILSQGQCIFKGVVTNLIPYLKGLGLHCPTYHNPADFIIEV 312

  Fly   363 AVGEHQRDLNELIHAANKKYYEDVDRHRYMSSDDMARLVESIKENMGGKAVVKTSEALAAFAAAQ 427
            |.||: .|||.::..|                                     ....|...|.. 
  Rat   313 ASGEY-GDLNPMLFRA-------------------------------------VQNGLCTMAEK- 338

  Fly   428 FSSFDYVKPSPQELALEEIKALSGGPESADPDLLEKNLRPQPQPLAKAGELARPP--NAIRSASF 490
                   |.||                       |||..|...|..       ||  :.|.|.:|
  Rat   339 -------KSSP-----------------------EKNEVPAHCPTC-------PPELDPIESHTF 366

  Fly   491 ----LMQYVLLMQRILICAKRNYFLLLARIFSHIFIGVVFGYLYMNVGNNAQSVLGNYVYLYGST 551
                |.|:.:|.:|..:...|:..|...|..||:.|||:.|.||:::|::|..|..|..:|:.|.
  Rat   367 ATSTLTQFCILFRRTFLSILRDTVLTHLRFMSHVLIGVLIGLLYLHIGDDASKVFNNTGFLFFSM 431

  Fly   552 LLLVYTGKMAVVLTFPL----EIDMLTREHFNRWYKLGPYFLSLISFEIPFQSLCTAMYIIISVH 612
            |.|::...|..|||..|    ::.:..|||.|.||.|..|:|:....::|||.:|..:|..|...
  Rat   432 LFLMFAALMPTVLTCELICLAKMAVFMREHLNYWYSLKAYYLAKTMADVPFQVVCPVVYCSIVYW 496

  Fly   613 LTGNDATDSFRIYYFMLLGIMASLSAQAWGFFVG-ATLPTKLAVFLGPILAVMFSVF-GFCTRYI 675
            :||..|..| |...|..|.|..:|.||:.|..:| |:...::|.|:||:.|:...:| ||...:.
  Rat   497 MTGQPAETS-RFLLFSALSIATALVAQSLGLLIGAASTSLQVATFVGPVTAIPVLLFSGFFVSFK 560

  Fly   676 DITPLFRWMWHLSYFRAGFHGALNAIYGMDRPFLECPETAMYCHFRSPKVFLKYMMISDVHMSDC 740
            .|....:|..:|||.|.||.|.:..||||:|..|.|.|.  :|.||.|::.|..:.:.:..:...
  Rat   561 TIPTYLQWSSYLSYVRYGFEGLILTIYGMERGHLTCLED--HCPFRDPQIILHELDVEEAKLYMD 623

  Fly   741 LILMGIVIGVMHVLTLITLWHKL 763
            .:::||....:.:|..:.|.:::
  Rat   624 FLVLGIFFLALRLLAYLVLRYRV 646

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17646NP_608618.1 ABCG_EPDR 103..333 CDD:213180 115/230 (50%)
3a01204 123..765 CDD:273361 238/654 (36%)
ABC2_membrane 497..698 CDD:279410 72/207 (35%)
Abcg4NP_001100286.1 3a01204 44..650 CDD:273361 247/699 (35%)
ABCG_EPDR 58..283 CDD:213180 115/230 (50%)
ABC2_membrane 377..583 CDD:279410 72/207 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1131
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D177791at33208
OrthoFinder 1 1.000 FOG0000096
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19241
Phylome 1 0.910 0.615 Consistency score
TreeFam 1 0.960
65.880

Return to query results.
Submit another query.