DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17646 and abcx-1

Sequence 1:NP_608618.1 Gene:CG17646 FlyBaseID:FBgn0264494 Length:766 Species:Drosophila melanogaster
Sequence 2:NP_495321.3 Gene:abcx-1 WormBaseID:WBGene00006522 Length:710 Species:Caenorhabditis elegans

Alignment Length:694 Identity:153/695 (22%)
Similarity:249/695 (36%) Gaps:184/695 (26%)


  Fly   126 VTKEILHGLNGSFRSGELTAIMGPSGAGKSTLLNVMSGFCST--GVSGDIRVNRKPMAPSSERFR 188
            |.|:.:|.::....|.::.|||....:...:||.::.|....  .:||||.||...|  |.:|..
 Worm    95 VLKQEVHNISFELSSSDVLAIMYTKESETISLLKIICGIKDVRGKLSGDILVNGHRM--SRDRLE 157

  Fly   189 QMLCYIHQDDLLRPQLLVGEIMLLAAHLKLGFKVTKAY--KMDLIKHILSLLGLDHRYNVPTGKL 251
            :.:.::   .|..|...:.....|..|......:|:.|  ...||..:::.|||....::...:|
 Worm   158 KTIGFV---SLESPTSTLSVRQYLHVHGNFYPPMTERYGGVGHLINKLMTDLGLFPVSDIICSRL 219

  Fly   252 SGGQKKRLAIALELISNPPVLYLDEPTTGLDSSSCSSCVALLKKLASQGHTIVCTIHQPSAL-IF 315
            :..|.:|:.:|.:|:.:|.:|...:....:|.......:..|::.|.:.:.||.....|::| |.
 Worm   220 NRSQWQRVKVASQLVRDPTILVCSDIFKDIDVHDQCFLIDYLREWAVKTNRIVIMAISPTSLQIL 284

  Fly   316 EMFDKLYTVVDGHCMYQGPVRELVPFLADQQLVCPSYHNPADYLLEVAVGEHQRDLNELIHAANK 380
            .||.|...:..|..:|.||.:.:..:.......||.|.|..|                       
 Worm   285 NMFSKAMILASGRMIYFGPPKSMQQYFETIGCPCPPYKNVCD----------------------- 326

  Fly   381 KYYEDVDRHRYMSSD-------DMARLVESIKENMGGKAVVKTSEALAAFAAAQFSSFDYVKPSP 438
             ||.|:..|..::||       .:||||.  |.|.....|.:|       |:.:|          
 Worm   327 -YYVDLVTHDNLTSDASRESSVRIARLVN--KWNQTAPPVRRT-------ASGKF---------- 371

  Fly   439 QELALEEIKALSGGPESADPDLLEKNLRPQPQPLAKAGELARPPNAIRSASFLMQYVLLMQRILI 503
                                 ||:         |..||...   |.:...| |..:..:..|   
 Worm   372 ---------------------LLD---------LPTAGIFM---NLLTLIS-LFWFNFINNR--- 399

  Fly   504 CAKRNYFLLLARIFS-------HIF-IGVVFGYLYMNVGNNAQSVLGNYVYLYGSTLLLVYTGKM 560
             |.|.:|||.  |||       |:. :.:.....::| .|:...:|..||.|:   :.||...| 
 Worm   400 -ASRIFFLLF--IFSLSTCLSLHLSDLSLTLPDAFLN-RNSYLELLIFYVPLF---IGLVNLKK- 456

  Fly   561 AVVLTFPLEID-----MLTREHFNRWYKLGP-------YFLSLISF--EIPF---QSLCTAMYII 608
               .||..|.|     :..|.|.....||.|       ..:.::||  |:||   .|:..||.:.
 Worm   457 ---CTFLSEFDKFYLFISARHHLKELLKLSPLKNMCSSLSIIIVSFVVELPFLLITSMVFAMPMS 518

  Fly   609 I--------SVHLTGNDATDSFRIYYFMLLGI-------MASLSAQAWGFF------------VG 646
            |        |.|||   :..|....:|:.|.:       :::||::...||            .|
 Worm   519 IFTDFHQKSSNHLT---SLVSISSSFFINLSVTQLVVNSVSNLSSEPLSFFFFVISWFSLFFACG 580

  Fly   647 ATLPT-KLAVFLGPILAVMFSVFGFCTRYIDITPLFRWMWHLSYFRAGFHGALN-----AIYGMD 705
            ...|. .:..:..|:.....|||.|.  |.|...|:..:            ::|     .:|...
 Worm   581 FPFPIHSILKYFNPLFFPTTSVFRFL--YEDSPSLYPQL------------SVNLSTPIQLYSCG 631

  Fly   706 RPFLECPE-TAMYCHFRSPKVFLKYMMISDVHMSDCLILMGIVI 748
            |.||...: |...|...|....|.|...::.......|..||:|
 Worm   632 RTFLNTTQVTRGPCQKVSSFELLSYYGFNESFDKQKSIFHGILI 675

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17646NP_608618.1 ABCG_EPDR 103..333 CDD:213180 50/212 (24%)
3a01204 123..765 CDD:273361 153/695 (22%)
ABC2_membrane 497..698 CDD:279410 58/254 (23%)
abcx-1NP_495321.3 P-loop_NTPase 102..302 CDD:304359 47/205 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1131
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1022017at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.