DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17646 and wht-2

Sequence 1:NP_608618.1 Gene:CG17646 FlyBaseID:FBgn0264494 Length:766 Species:Drosophila melanogaster
Sequence 2:NP_502164.1 Gene:wht-2 WormBaseID:WBGene00007513 Length:610 Species:Caenorhabditis elegans

Alignment Length:671 Identity:164/672 (24%)
Similarity:282/672 (42%) Gaps:125/672 (19%)


  Fly   102 DPVDIQFADVRYTVKKFSFPERKFVTKEILHGLNGSFRSGELTAIMGPSGAGKSTLLNVMSGFCS 166
            |||.:.:.::....:|..        |:||..::|..:.|:|.|:||.|||||:||||::.....
 Worm    30 DPVTLTWHNISIHAEKSG--------KQILENVSGIAKPGQLLALMGASGAGKTTLLNMLLSRNL 86

  Fly   167 TGV--SGDIRVNRKPMAPSSERFRQMLCYIHQDDLLRPQLLVGEIMLLAAHLKLGFKVTKAYKMD 229
            .|:  ||.::||...:   ......:..|..||:|....|.|.|.:.:.|.|::.....|..:. 
 Worm    87 RGLETSGSVKVNGHEL---GRGITAISGYAQQDELFVGTLTVKEYLDIQAKLRVNGDSEKRRRR- 147

  Fly   230 LIKHILSLLGLDHRYNVPTGK------LSGGQKKRLAIALELISNPPVLYLDEPTTGLDSSSCSS 288
             :.:::|.|||....|...|.      :|||:.:||..|.||:|||.:|:.|||||||||....|
 Worm   148 -VGNVMSQLGLYKCQNTRIGTIGGQKGISGGEMRRLTFACELLSNPSILFCDEPTTGLDSFMAES 211

  Fly   289 CVALLKKLASQGHTIVCTIHQPSALIFEMFDKLYTVVDGHCMYQGPVRELVPFLADQQLVCPSYH 353
            .|.:|..||..|.|::|||||||:.::.|||::..:..|...:.|..|:.:.|..|....||...
 Worm   212 VVQVLSNLAKSGRTVICTIHQPSSQLYLMFDRVMFMAGGKTAFLGSPRDAIQFFEDAGFACPRNF 276

  Fly   354 NPADYLLE-VAVGEHQRDLNELIHAANKKYYEDVDRHRYMSSDDMARLVESIKENMGGKAVVKTS 417
            ||||.::. :||..::               ||..|.|          :|.|             
 Worm   277 NPADLIIHTLAVMPNE---------------EDKCRQR----------IEVI------------- 303

  Fly   418 EALAAFAAAQFSSFDYVKPSPQELALEEIKALSGGPESADPDLLEKNLRPQPQPLAKAGELARPP 482
                 :...|.||:.              :.|..|.|.:|.                    .:.|
 Worm   304 -----YTKFQNSSYG--------------RTLKFGVEKSDE--------------------GQRP 329

  Fly   483 NAIRSASFLMQYVLLMQRILICAKRNYFLLLARIFSHIFIGVVFGYLYM-----NVGNNAQSVLG 542
            :.......|.|...|::|..|...||..|..|::.....:|:..|.||:     ::|  ..::.|
 Worm   330 SERHKTGILTQIGALLERSAIDTWRNPSLTRAKVIQKSIMGLFIGLLYLQSPLTSIG--ISNLNG 392

  Fly   543 NYVYLYGSTLLLVYTGKMAVVLTFPLEIDMLTREHFNRWYKLGPYFLSLISFEIPFQSLCTAMYI 607
            ...||   ...|.|:....::...|.:..:::||:.:..|.:..|:::.....:|..:....:.:
 Worm   393 ALFYL---VCELTYSTIFGILNFLPADFPLVSREYHDGLYSVFSYYVARCLSYLPLFTADGLIML 454

  Fly   608 IISVHLTGNDATDSFRIYYFMLLGIMASLSAQAWGFFVGA---TLPTKLAVFLGPILAVMFSVFG 669
            ::|..:.|..::.: ::.|..|:..:...|:.|.|..:..   :||..::. .||:|.::....|
 Worm   455 LVSYWMVGFSSSIT-QVLYACLIAFLIEQSSSACGIMISCISPSLPIAMST-AGPMLTLLSLTGG 517

  Fly   670 FCTRYIDITPLFRWMWHLSYFRAGFHG-ALNAIYGMDRPFLECPETAMYCHFRSPKV-----FLK 728
            .......:.....|:.:||:||.||.. |:|....::.     ..|.::...:...|     |..
 Worm   518 LYANVGALPSYISWIQYLSWFRYGFEAFAINQWSSVNE-----QNTTIWTDEKRDSVLSQLSFRA 577

  Fly   729 YMMISDVHMSDCLILMGIVIG 749
            .|...|:.:....||:...||
 Worm   578 EMFYPDLFIMSAFILIFYTIG 598

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17646NP_608618.1 ABCG_EPDR 103..333 CDD:213180 81/238 (34%)
3a01204 123..765 CDD:273361 160/651 (25%)
ABC2_membrane 497..698 CDD:279410 44/210 (21%)
wht-2NP_502164.1 ABCG_EPDR 31..256 CDD:213180 81/238 (34%)
3a01204 44..610 CDD:273361 161/658 (24%)
ABC2_membrane 344..548 CDD:279410 44/211 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1022017at2759
OrthoFinder 1 1.000 FOG0000096
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.