DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17646 and wht-3

Sequence 1:NP_608618.1 Gene:CG17646 FlyBaseID:FBgn0264494 Length:766 Species:Drosophila melanogaster
Sequence 2:NP_497825.2 Gene:wht-3 WormBaseID:WBGene00007631 Length:614 Species:Caenorhabditis elegans

Alignment Length:703 Identity:160/704 (23%)
Similarity:300/704 (43%) Gaps:142/704 (20%)


  Fly    61 ETSSTSSRGSCELTSKVTNDLNGFQSPNYHQAVAHANFDHCDPVDIQFADVRYTVKKFSFPERKF 125
            |:..|||:   :||..||                        |:.:.:.::....:|..|.::: 
 Worm    21 ESIDTSSQ---KLTEVVT------------------------PITVTWENIEVKTRKKLFSKKQ- 57

  Fly   126 VTKEILHGLNGSFRSGELTAIMGPSGAGKSTLLNVMSGFCSTGV--SGDIRVNRKPMAPSSERFR 188
              |::|:.::|..:.||:.|:||.|||||:||:||:......|:  :|.::||...:   .:...
 Worm    58 --KQLLNRVSGIAKPGEMVALMGASGAGKTTLMNVLMCRNMKGLEKNGTVKVNGTKI---GKEIS 117

  Fly   189 QMLCYIHQDDLLRPQLLVGEIMLLAAHLKLGFKVTKAYKMDLIKHILSLLGLDHRYNVPTGK--- 250
            .:..:..|.::..|.|.|.|.:::.|.|::  |..|..:.:.:..|:.:|.|.:..::..|.   
 Worm   118 LISGFAQQQEIFIPTLTVDEYLMIQARLRM--KANKHTRRERVDEIIEMLRLQNCRDLKIGTPGL 180

  Fly   251 ---LSGGQKKRLAIALELISNPPVLYLDEPTTGLDSSSCSSCVALLKKLASQGHTIVCTIHQPSA 312
               :|||:.:||..|.||:|||.:|:.||||:||||...:|.|.:||.||:.|.|:   ||||:|
 Worm   181 VKGISGGEARRLTFACELLSNPSLLFADEPTSGLDSFMAASVVQILKNLANSGRTL---IHQPTA 242

  Fly   313 LIFEMFDKLYTVVDGHCMYQGPVRELVPFLADQQLVCPSYHNPADYLLEVAVGEHQRDLNELIHA 377
            .:|..|||:..:..|...:.|...|.|.|.||.....|...||.:::        |..|:.:.:.
 Worm   243 ELFFQFDKIIFLSMGKTAFMGTPHESVKFFADCGHPIPKLFNPPEWI--------QSKLSVIPNN 299

  Fly   378 ANKKYYEDVDRHRYMSSDDMARLVESIKENMGGKAVVKTSEALAAFAAAQFSSFDYVKPSPQELA 442
            ..|            |.:.:.:::|.                             |.|....:.:
 Worm   300 ETK------------SRETIGKIIEF-----------------------------YEKSIIHQKS 323

  Fly   443 LEEIKALSGGPESADPDLLEKNLRPQPQPLAKAGELARPPNAIRSASFLMQYVLLMQRILICAKR 507
            :.||:.::                        ..||   |..|.:..|..:...|::|..:...|
 Worm   324 IVEIRVIA------------------------TTEL---PPYIENPGFFAETGALLKRACLDVIR 361

  Fly   508 NYFLLLARIFSHIFIGVVFGYLYMNVGNNAQSVLGNYVYLYGSTLLLVYTGKMAVVLTFPLEIDM 572
            :...:..::...:.:|:..|.||.....:.:.|......||.....|.::....::.....|:.:
 Worm   362 SPAQMRMKLIQKVVMGLFIGSLYWQQPLDPRGVRNTNSALYFLIAELTFSTMFGIMTFMEHELPL 426

  Fly   573 LTREHFNRWYKLGPYFLSLISFEIPFQSLCTAMYIIISVHLTGNDATDSFRIYYFMLLGIMASLS 637
            :.||:.:..:.:..|::|.....:|..::..|:.|:||..:.|.::|.. ::...:|:.::...|
 Worm   427 IAREYHDGLFYVISYYISRFLSYLPLFTIDGALMIVISYWMIGLNSTWQ-QVAKSILISVLVEQS 490

  Fly   638 AQAWGFFVGATL-PTKLAV-FLGP---ILAVMFSVFGFCTRYIDITPLF-RWMWHLSYFRAGFHG 696
            |.:.|.|:.... .|.||: |..|   :.|::..::|....:    |:: |||...|:.|.||.|
 Worm   491 ATSCGLFLACLFETTSLAIAFAVPASGLFALLSGLYGNTNNF----PVYIRWMQWTSWCRYGFEG 551

  Fly   697 -ALNAIYGMDRPFLECPETAMYCHFRSPKVFLKYMMISDVHMSDCLILMGIVI 748
             .:|....:|.|        .:..|....:..::....|.:..|.:.|..|||
 Worm   552 LVVNQWSQVDNP--------KWDPFYRELILKQFSFNKDNYQLDVIGLCSIVI 596

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17646NP_608618.1 ABCG_EPDR 103..333 CDD:213180 75/238 (32%)
3a01204 123..765 CDD:273361 149/642 (23%)
ABC2_membrane 497..698 CDD:279410 44/208 (21%)
wht-3NP_497825.2 ABCG_EPDR 36..263 CDD:213180 75/238 (32%)
3a01204 37..614 CDD:273361 151/661 (23%)
ABC2_membrane 351..555 CDD:279410 44/209 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1131
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1022017at2759
OrthoFinder 1 1.000 FOG0000096
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.