DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17646 and abch-1

Sequence 1:NP_608618.1 Gene:CG17646 FlyBaseID:FBgn0264494 Length:766 Species:Drosophila melanogaster
Sequence 2:NP_495320.1 Gene:abch-1 WormBaseID:WBGene00016973 Length:595 Species:Caenorhabditis elegans

Alignment Length:661 Identity:131/662 (20%)
Similarity:226/662 (34%) Gaps:213/662 (32%)


  Fly   129 EILHGLNGSFRSGELTAIMGPSGAGKSTLLNVMSGFCSTGVSGDI-------------------- 173
            :||..::.:..|||:.||:|.:.:||:|||..:    ::|..|||                    
 Worm    35 QILKNISFTATSGEIHAIVGVADSGKTTLLEAL----TSGAGGDIGGIAMLDKFMLTRRRFNKFC 95

  Fly   174 -RVNRKPMAPSSERFRQMLCYIHQDDLLRPQLLVGEIMLLAAHLKLGFKVTKAYKMDLIKHILSL 237
             .:|.:...|||...|.:| |.|           ..:.|.:.|..|...    :::..:..:..:
 Worm    96 SHINYRNQYPSSLSVRSLL-YYH-----------ARLCLSSTHTSLEID----HRISELSAMFDV 144

  Fly   238 LGLDHRYNVPTGKLSGGQKKRLAIALELISNPPVLYLDEPTTGLDSSSCSSCVALLKKLASQ-GH 301
            :|..|.   ....||...::|:...:||:.:|.:..:|:||..|...|....:..|...|:: ..
 Worm   145 IGYAHD---KLEDLSFSARRRVMTVMELLKDPILTIIDDPTAYLSPLSAYQLIYALHFYAAKFNR 206

  Fly   302 TIVCTIHQPSALIFEMFDKLYTVVDGHCMYQGPVRELVPFLADQQLVCPSYHNPADYLLEVAVGE 366
            .|:.|:....:.:..:......:..|...|.|.:|.|..........||...|||.|        
 Worm   207 IIIITLRNVRSDLSHLLGSATCLFYGEVAYSGQMRLLPNHFKKAGFECPPNENPAAY-------- 263

  Fly   367 HQRDLNELIHAANKKYYEDVDRHRYMSSDDMARLVESIKENMGGKAVVKTSE---ALAAFAAAQF 428
                                    |:|      |:...||:|  :.|::|.|   .|.||.....
 Worm   264 ------------------------YLS------LLTIDKESM--QKVMETQEKATKLVAFRTDND 296

  Fly   429 SSFDYVKPSPQELALEEIKALSGGPESADPDLLEKNLRPQPQPLAKAGELAR---------PPNA 484
            :|.|                :||...:....||:.. |..|.....|..|.|         |.|:
 Worm   297 TSSD----------------ISGSSATGTGVLLDSG-RKNPSISTVAAILFRRVLSLIGSTPSNS 344

  Fly   485 IRS-ASFLMQYVLLMQRILICAKRNYFLLLARIFSHIFIGVVFGYLYMNVGNNAQSVLGNYVYLY 548
            :.. .:|.:...:|.           ||....:.|.:|...:..:||                  
 Worm   345 LAGLIAFPVTAAVLS-----------FLRPTSLPSSLFFWKLLTFLY------------------ 380

  Fly   549 GSTLLLVYTGKMAVVLTFPLEIDMLTREHFNRWYKLGPYFLSLISF-EIPFQSLCTAMYIIISVH 612
                ||:.|     ::.||         ::::        .||:|| |.......|::.|     
 Worm   381 ----LLLQT-----IVIFP---------NYSK--------TSLLSFRECNLYCQTTSLTI----- 414

  Fly   613 LTGNDATDSFRIYYFMLLGIMASL--SAQAWGFFVGATLPTKLAVFLGPILAVMFSVFGFCTRYI 675
                     |.|::.:...|.:||  ....|.|...|.....|.:||..|.:  ||:|..|.||:
 Worm   415 ---------FSIFFLVYSCIQSSLFVGIVLWSFKSEAMFQISLNLFLLSIFS--FSIFTICARYL 468

  Fly   676 ----DITPLFRWMWHLSYFRAG-------FHGALNAIYGMDRPFLECPETAMYCHFRSPKVFLKY 729
                :|. :.:.:..|::|.:|       ...::....|:..||       .|.:|     .|..
 Worm   469 KNCSNIV-ILQTIIILAFFVSGNGVTGTTTSSSIQYYIGVINPF-------NYSNF-----LLSK 520

  Fly   730 MMISDVHMSDC 740
            ::.|.:...:|
 Worm   521 LLSSSIDNEEC 531

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17646NP_608618.1 ABCG_EPDR 103..333 CDD:213180 47/226 (21%)
3a01204 123..765 CDD:273361 131/662 (20%)
ABC2_membrane 497..698 CDD:279410 41/215 (19%)
abch-1NP_495320.1 P-loop_NTPase 18..238 CDD:304359 47/226 (21%)
ABC_phnC 25..246 CDD:131368 50/234 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1131
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.