DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17646 and Abcg5

Sequence 1:NP_608618.1 Gene:CG17646 FlyBaseID:FBgn0264494 Length:766 Species:Drosophila melanogaster
Sequence 2:NP_446206.2 Gene:Abcg5 RGDID:620298 Length:652 Species:Rattus norvegicus

Alignment Length:761 Identity:170/762 (22%)
Similarity:304/762 (40%) Gaps:206/762 (27%)


  Fly    55 SELSIDETSSTSSR-----GSCELTSKVTNDLNGFQSPNYHQAVAHANFDHCDPVDIQFADVRYT 114
            |:.|::|.|.|.|.     |...::..|:|.:..:.           |...|             
  Rat    21 SQSSLEEGSVTGSEARHSLGVLNVSFSVSNRVGPWW-----------NIKSC------------- 61

  Fly   115 VKKFSFPERKFVTKEILHGLNGSFRSGELTAIMGPSGAGKSTLLNVMSG-FCSTG-VSGDIRVNR 177
                   ::|: .::||..::....||:...|:|.||:||:|||:.:|| ...|| :.|::.||.
  Rat    62 -------QQKW-DRKILKDVSLYIESGQTMCILGSSGSGKTTLLDAISGRLRRTGTLEGEVFVNG 118

  Fly   178 KPMAPSSERFRQMLCYIHQDDLLRPQLLVGEIMLLAAHLKLGFKVTKAYKMDLIKHILSLLGLDH 242
            ..:  ..::|:..:.|:.|.|:....|.|.|.:...|.|.|.......|... ::.:|:.|.|.|
  Rat   119 CEL--RRDQFQDCVSYLLQSDVFLSSLTVRETLRYTAMLALRSSSADFYDKK-VEAVLTELSLSH 180

  Fly   243 -------RYNVPTGKLSGGQKKRLAIALELISNPPVLYLDEPTTGLDSSSCSSCVALLKKLASQG 300
                   .||.  |.:|.|:::|::||.:|:.:|.|:.|||||||||..:.:..|.||.:||.:.
  Rat   181 VADQMIGNYNF--GGISSGERRRVSIAAQLLQDPKVMMLDEPTTGLDCMTANHIVLLLVELARRN 243

  Fly   301 HTIVCTIHQPSALIFEMFDKLYTVVDGHCMYQGPVRELVPFLADQQLVCPSYHNPADYLLEVAVG 365
            ..::.|||||.:.:|..|||:..:..|..::.|...|::.|..:....||.:.||.|:.:::...
  Rat   244 RIVIVTIHQPRSELFHHFDKIAILTYGELVFCGTPEEMLGFFNNCGYPCPEHSNPFDFYMDLTSV 308

  Fly   366 EHQRDLNELIHAANKKYYEDVD--RHRYMSSDDMARLVESIKENMGGKAVVKTSEALAAFAAAQF 428
            :.|....|:      :.|:.|.  ...:..||...:::|:|:..                     
  Rat   309 DTQSREREI------ETYKRVQMLESAFRQSDICHKILENIERT--------------------- 346

  Fly   429 SSFDYVKPSPQELALEEIKALSGGPESADPDLLEKNLRPQPQPLAKAGELARPPNAIRSASFLMQ 493
                           ..:|.|        |.:..|...| |....|.|                 
  Rat   347 ---------------RHLKTL--------PMVPFKTKNP-PGMFCKLG----------------- 370

  Fly   494 YVLLMQRILICAKRNYFLLLARIFSHIFIGVVFGYLYMNVGNN-----AQSVLGNYVYLYGSTLL 553
              :|::|:.....||..:::.|:..::.:|:...:..:.|.||     .|..:|....|.|:|  
  Rat   371 --VLLRRVTRNLMRNKQVVIMRLVQNLIMGLFLIFYLLRVQNNMLKGAVQDRVGLLYQLVGAT-- 431

  Fly   554 LVYTGKMAVVLTFPLEIDMLTREH----FNRWYKLGPYFLSLISFEIP----FQSLC---TAMY- 606
             .|||.:..|..||:...:..:|.    :.:|..|..|.|..:.|.|.    |.|:|   ..:| 
  Rat   432 -PYTGMLNAVNLFPMLRAVSDQESQDGLYQKWQMLLAYVLHALPFSIVATVIFSSVCYWTLGLYP 495

  Fly   607 ----------IIISVHLTGNDATDSFRIYYFMLLG----------IMASLSAQAWGFFVGA---- 647
                      .:::.||.|...|       .:|||          |:|.||..  |..:|:    
  Rat   496 EVARFGYFSAALLAPHLIGEFLT-------LVLLGMVQNPNIVNSIVALLSIS--GLLIGSGFIR 551

  Fly   648 ---TLPTKLAVFLGPILAVMFSVFGFCTRYIDITPLFRWMWHLSYFRAGFHGAL--NAIYGMDR- 706
               .:|..|.: ||     .|:...:|...:.:...:    .|::...|.:.::  |.:..|.: 
  Rat   552 NIEEMPIPLKI-LG-----YFTFQKYCCEILVVNEFY----GLNFTCGGSNTSVPNNPMCSMTQG 606

  Fly   707 -PFLE--CP-ETAMYCHFRSPKVFLKYMMISDVHMSDCLILMGIVI 748
             .|:|  || .|:.:    :....:.|..|      ..|:::|:|:
  Rat   607 IQFIEKTCPGATSRF----TTNFLILYSFI------PTLVILGMVV 642

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17646NP_608618.1 ABCG_EPDR 103..333 CDD:213180 71/239 (30%)
3a01204 123..765 CDD:273361 159/689 (23%)
ABC2_membrane 497..698 CDD:279410 52/245 (21%)
Abcg5NP_446206.2 ABCG_White 50..276 CDD:213201 74/263 (28%)
3a01204 61..646 CDD:273361 160/711 (23%)
ABC2_membrane 372..579 CDD:279410 50/225 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1131
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1022017at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.