DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17646 and abcg8

Sequence 1:NP_608618.1 Gene:CG17646 FlyBaseID:FBgn0264494 Length:766 Species:Drosophila melanogaster
Sequence 2:XP_017949465.1 Gene:abcg8 XenbaseID:XB-GENE-981625 Length:706 Species:Xenopus tropicalis

Alignment Length:658 Identity:158/659 (24%)
Similarity:294/659 (45%) Gaps:108/659 (16%)


  Fly   131 LHGLNGSFRSGELTAIMGPSGAGKSTLLNVMSGFCSTG--VSGDIRVNRKPMAPSSERFRQMLCY 193
            :..:|....||::.|::|.:|.||::||::::.....|  .||.|.:|.|  ..:..|.::.:.:
 Frog   114 MKNINVKVTSGQMLAVIGNTGCGKTSLLDIITCKDEGGKIKSGQILINGK--VSTKHRVKKCVAH 176

  Fly   194 IHQDDLLRPQLLVGEIMLLAAHLKLGFKVTKAYKMDLIKHILSLLGLDHRYNVPTGK-----LSG 253
            :.|||.|.|.|.|.|.:...|.|:|....::..:...::.:::.|.|....|...|.     :||
 Frog   177 VRQDDQLLPHLTVRETLTFIAKLRLPKSYSEEQRRRQVEDVIAELRLRQCANTKVGNTYTRGVSG 241

  Fly   254 GQKKRLAIALELISNPPVLYLDEPTTGLDSSSCSSCVALLKKLASQGHTIVCTIHQPSALIFEMF 318
            |:::|::|.::|:.||.:|.|||||:||||.:..:.|..|.:||.....::.:||||.:.||::|
 Frog   242 GERRRVSIGVQLLWNPGILILDEPTSGLDSFTAHNLVITLSRLARGNRLVLLSIHQPRSDIFQLF 306

  Fly   319 DKLYTVVDGHCMYQGPVRELVPFLADQQLVCPSYHNPADYLLEVAVGEHQRDLNELIHAANKKYY 383
            |.:..:..|..:|.|..:::|.:.:.....||.|.||||:.:         ||..:.....::..
 Frog   307 DLVLLLSSGATIYSGTAKDMVEYFSSIGYPCPRYSNPADFYV---------DLTSIDQRNKERET 362

  Fly   384 EDVDRHRYMSSDDMARLV-ESIKEN---------MGGKAVVKTSEALAAFAAAQFSSFDYVKPSP 438
            |.::|.|     .:|.:. |.:|::         ...|.:..|:.::            .:..|.
 Frog   363 ESLERTR-----SLAEIFWEKVKDSDDFLWKPPGEANKNITPTNTSI------------NLPVSA 410

  Fly   439 QELALEEIKALSGGPESADPDLLEKNLRPQPQPLAKAGELARPPNAIRSASFLMQYVLLMQRILI 503
            .|.|: :||       ::|.|.|.:.|.                          |:.:|::|.:.
 Frog   411 HEKAI-KIK-------NSDVDQLPRGLH--------------------------QFSVLLRRHVS 441

  Fly   504 CAKRNYFLLLARIFSHIFIGVVFGYLYMNVGNNAQSVLGNYVYLYGSTLLLVYTGKMAVVLTFPL 568
            ...|:...||...|..:.:.::.|:||...|||..|:..:...|:....|..:...:.||.....
 Frog   442 NDLRDLSTLLIHGFEALVMALLIGFLYYGQGNNQLSIQDSIALLFMKGSLTPFAVVLDVVAKCHS 506

  Fly   569 EIDMLTREHFNRWYKLGPYFLSLISFEIPFQSLCTAMYIIISVHLTG-NDATDSFRIYYFMLLGI 632
            |..||..:..:..|.:.|||.:.:..|:|........|.:....|.. |...:.|.:.:.:||.|
 Frog   507 ERAMLYHDLEDGLYSVTPYFFAKVIGELPEHFAFVIFYGVPIYWLANLNPHPECFLLNFALLLLI 571

  Fly   633 MASLSAQAWGFFVGATLPT-KLAVFL-GPILAVMFSVFGFCTRYIDITPLFRWMWHLSYFRAGFH 695
            :  ..::|...::.|.||| :::.|| ..|....:...||..|..::..:..|:.::|:.|.||.
 Frog   572 V--YCSRAMALWMSALLPTLQMSSFLSNAIFTSSYLTGGFIIRLENLWTVPYWISYVSFLRWGFE 634

  Fly   696 GALNAIYGMDRPF--------LECPETAMYCHFRSPKVFLKYMMISDVH--MSDCLILMGIVIG- 749
            |.:...: .|..:        :..|.||:..:           |..|.|  .:..|:|:||:.| 
 Frog   635 GLMQVQF-TDLSYKVPVGNITITIPGTAIISN-----------MEMDSHPLYASYLVLIGIIAGF 687

  Fly   750 -VMHVLTL 756
             |::.|:|
 Frog   688 LVLYYLSL 695

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17646NP_608618.1 ABCG_EPDR 103..333 CDD:213180 64/209 (31%)
3a01204 123..765 CDD:273361 158/659 (24%)
ABC2_membrane 497..698 CDD:279410 50/204 (25%)
abcg8XP_017949465.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1131
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1022017at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.