DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: frtz and Wdpcp

Sequence 1:NP_001259879.1 Gene:frtz FlyBaseID:FBgn0086698 Length:951 Species:Drosophila melanogaster
Sequence 2:NP_001121009.1 Gene:Wdpcp RGDID:1309501 Length:726 Species:Rattus norvegicus

Alignment Length:706 Identity:205/707 (29%)
Similarity:341/707 (48%) Gaps:89/707 (13%)


  Fly     3 LSETHFWTTLREDVVRIKSQDLGAFRYLRQRD---------KEQEQQDLACLAKRDYTERRNGLA 58
            |:|.|.|:.  :..:.|..:|:|.::|..::|         ..:|:|.||  ..|||.      .
  Rat     5 LTELHLWSL--KSTLHIADRDIGVYQYYDKKDLPVSAAEHGNLEEKQRLA--ESRDYP------W 59

  Fly    59 VLKNSGRKSTGRLKDNLKKLEDLLRQHRIIHSEWQDAAQVLLLFSHGLIAHICVDIYTGDILRMV 123
            .|||   :...:|:|:||:||:|::..:.:..:|:......|||..|::  :.:.:....:.::|
  Rat    60 TLKN---RRPEKLRDSLKELEELMQNSQCVLCQWKSKHICQLLFGSGVL--VSLSLSGPQLEKVV 119

  Fly   124 FEKYLVGKLASEVITDAFFTRSHIVLAY-NTNQLTVVHLQRP------NARSQGPEKIANMDPRI 181
            .::.|||||.|:.|:||..|.|.|:|:: ..|:|..:...:.      |.|.   ||::.:|.:|
  Rat   120 IDRSLVGKLISDTISDALLTDSFIILSFLAQNKLCFIQFAKKMDSLDVNKRL---EKLSALDYKI 181

  Fly   182 FHVIIPGATERKLSRHLTVNASFDLFVVWTQSSQNEVYPWRPTIRDQDRANIHV--FKIKGLQ-L 243
            .:..|||...|.:.|||.:|::.||.|.|.....::.:||.|...::||||:.:  |...||: |
  Rat   182 SYHDIPGPATRTVDRHLAINSTQDLAVCWWPLLSDDAWPWTPIASEKDRANMLLLGFTQGGLEVL 246

  Fly   244 ESIAYCWSENDPLCVDFLRSSESQIITLEQKVSRKGDISAEICSYELAAGKMQRTAITSIPMGAQ 308
            .|:...|   :||.|.|......|:.|:|...|...:..|:.|.||....|:...::|.||:.::
  Rat   247 SSVRTEW---NPLDVHFGTRQPYQVFTVECSFSVDQEPMADSCIYESVRNKLHCVSVTRIPLRSK 308

  Fly   309 ICSFAFSPDQEKLFLGSVDRNICLHDLVQQSTKYANQIEIVPNQCAWHCDSAMLCVANERSVLQC 373
            ..|...:..::||.:|..|.::.|::..:..|..| |.|::|:..:.|...|:|.|.:.:..||.
  Rat   309 AISCCKNSTEDKLIVGCEDSSVILYEAHRGVTLLA-QAELMPSLISCHPSGAILLVGSNQGELQV 372

  Fly   374 FDLALATIGHQLVSENVTPSSLLDLSHYFVAQPTLLSVAFSRKPDLSTFKHTYAQTDC-LLLLVY 437
            ||:||:.|..||::|:..|...|..:.:|....:|:.:.:...|  ..|:.......| ||.|.:
  Rat   373 FDIALSPINIQLLAEDCLPKETLQFNKFFDFSSSLVHMQWIAPP--IVFQKPKRGEICDLLFLRF 435

  Fly   438 EQGPLACMRIFGGTGMRGDIHNSGLTADVIADKYLRLQQPDRAVNVLAALNWETYGAMCLITLHK 502
            .:|||..:....|...||.:   || .|:|. :|:...:...||:||:::||:|.|..|.|::..
  Rat   436 NRGPLGVLLFKLGVLRRGQL---GL-VDLIF-QYIHCDEVYEAVSVLSSMNWDTLGQQCFISMST 495

  Fly   503 IANYVFFGGDQR-RPRIELMARA-LKTF---AHTLSEETKDEFSDQVYDLKRRFCFYLLRKNLFA 562
            |.|::.   .|| .|..|....| |.||   |..|.:.|...:.|.|....||...:|||...|.
  Rat   496 IVNHLL---RQRLTPEREAQLEASLGTFYAPARPLLDTTVLAYRDPVGTYARRLFHHLLRYQRFE 557

  Fly   563 EAFEIAQDVADYDIFMDLYNLTKCISSLSEFAQVAFSQAAAIIHEEDRANGNLSLTCDLRSESAC 627
            :||.:|.|:...|:|||::.|...:..|: .|:||..:|.                 |:..||.|
  Rat   558 KAFLLAVDIGARDLFMDIHYLALDMGELA-LAEVARRRAD-----------------DIDVESVC 604

  Fly   628 S----LSTCS--DMLRGQGAGTA--PETG------LGASQPQSQQVLKNYVPPLPS 669
            |    |....  |||....||:|  ||.|      |.:|....:..::..:|..||
  Rat   605 SGVELLGPLDRRDMLNEGFAGSALTPEGGNPFPDLLPSSGSTPKHTIQQKIPNGPS 660

Known Domains:


GeneSequenceDomainRegion External IDIdentity
frtzNP_001259879.1 DUF3312 47..596 CDD:288601 169/565 (30%)
WD40 <308..384 CDD:295369 22/76 (29%)
WdpcpNP_001121009.1 DUF3312 48..591 CDD:288601 173/574 (30%)
WD 1 305..343 7/38 (18%)
WD40 repeat 310..345 CDD:293791 9/36 (25%)
WD 2 344..383 14/39 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C257090900
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H9299
Inparanoid 1 1.050 229 1.000 Inparanoid score I3323
OMA 1 1.010
OrthoDB 1 1.010 D306370at33208
OrthoFinder 1 1.000 FOG0006940
OrthoInspector 1 1.000 T1088280
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13667
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
1010.010

Return to query results.
Submit another query.