DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: frtz and wdpcp

Sequence 1:NP_001259879.1 Gene:frtz FlyBaseID:FBgn0086698 Length:951 Species:Drosophila melanogaster
Sequence 2:XP_005158592.1 Gene:wdpcp ZFINID:ZDB-GENE-100405-4 Length:707 Species:Danio rerio

Alignment Length:739 Identity:180/740 (24%)
Similarity:318/740 (43%) Gaps:101/740 (14%)


  Fly     3 LSETHFWTTLREDVVRIKSQDLGAFRYLRQRDKEQEQQDLACLAKRDYTERRNGLAVLKNSGRKS 67
            |:|.|.|:.  .:.:::..:|:|.::...:.:............|:.:.:.|.....|.|   :.
Zfish     5 LAELHLWSF--RNSLQVPDRDIGTYQLYEKGEPASPTDQHYYNEKQQFADSRGYPWFLSN---RR 64

  Fly    68 TGRLKDNLKKLEDLLRQHRIIHSEWQDAAQVLLLFSHGLIAHICVDIYTG--DILRMVFEKYLVG 130
            ..:|:|.||:||:||:...::...|:......:|...|::    |.:..|  .:.|:|.::.|||
Zfish    65 PEKLRDALKELEELLQSCPVMSVRWRSKQCCQMLLRSGVL----VTLILGGAQVERVVIDRTLVG 125

  Fly   131 KLASEVITDAFFTRSHIVLA-YNTNQLTVVHLQRPNARS----QGPEKIANMDPRIFHVIIPGAT 190
            :|.::.|:||......::.: ...:|:..|:|.|.|..|    :..||:...:.::....:||. 
Zfish   126 RLPADTISDAVIGDRFLLFSLMERSQVCQVYLNRKNQSSPDLARHMEKLTAAEIKVSVADLPGG- 189

  Fly   191 ERKLSRHLTVNASFDLFVVWTQSSQNEVYPWRPTIRDQDRANIHVFKIK---GLQ-LESIAYCWS 251
            .|::.|||.:|.:.|:.|.|......||.||.|.....||||:.:....   ||. |.||.   :
Zfish   190 GRRVERHLGLNRTQDVAVCWWPLCNEEVRPWSPIPSAADRANLVLLACSDTPGLTVLSSIR---T 251

  Fly   252 ENDPLCVDFLRSSESQIITLEQKVSRKGDISAEI----------CSYELAAGKMQRTAITSIPMG 306
            :.||:...|..:....|:|:|.....|...|..:          |.|||..|::||.:..|:.:.
Zfish   252 DGDPIDCRFSLTQPYHILTVELHQDTKHSTSESLEEIQHPDIQTCVYELTRGRLQRLSSISLTLT 316

  Fly   307 AQICSFAFSPDQEKLFLGSVDRNICLHDLVQQSTKYANQIEIVPNQCAWHCDSAMLCVANERSVL 371
            ::..:.:..|.:..:.||..|.::.|.|.....:::|. ..::|...|||...::|.|...:..|
Zfish   317 SKPITCSRDPLERWVVLGLQDCSVVLFDPQTGLSQWAT-CSMMPAVLAWHPSGSLLVVGGGQGEL 380

  Fly   372 QCFDLALATIGHQLVSENVTPSSL---LDLSHYFVAQPTLLSVAFSRKPDLSTFKHTYAQTDCLL 433
            ||||:..:.:..:||||...|.|:   |.||.:|.....|..:.::..| :|....:....| ||
Zfish   381 QCFDMGFSPLPLRLVSEEPVPGSVGSSLQLSQHFNTSEGLEGIQWAYCP-ISQGNESLEVHD-LL 443

  Fly   434 LLVYEQGPLACMR----IFGGTGMRGDIHNSGLTADVIADKYLRLQQPDRAVNVLAALNWETYGA 494
            ||.:..||||.:|    :|.|..:.        ..|:|..:.| .::.|.|:.:|..::|...||
Zfish   444 LLRFHGGPLAALRLKLGVFNGAQLG--------PCDLILHRLL-CEEVDAALGILGNMDWAIMGA 499

  Fly   495 MCLITLHKIANYVFFGGDQRRPRIE----LMARALKTF---AHTLSEETKDEFSDQVYDLKRRFC 552
            .|..:|..|.:::.     |:|..:    .:..||..|   ...||.....|:.|.:....|||.
Zfish   500 ECYRSLISITDHLL-----RKPLDQQTEGQLEAALGVFYAPCRPLSNTVILEYRDPISRYARRFF 559

  Fly   553 FYLLRKNLFAEAFEIAQDVADYDIFMDLYNLTKCISSLSEFAQVAFSQAAAIIHEEDRANGNLSL 617
            .:|||...|.:||.:|.|:...|:||||:.:.      ::..:|..:..|     :.:||     
Zfish   560 HHLLRHQRFEKAFLLAVDIGARDLFMDLHYVA------ADKGEVVLAAVA-----KKKAN----- 608

  Fly   618 TCDLRSESACSL-STCSDMLRGQGAGTAPET-----------------GLGASQPQSQQVLKNYV 664
              ::.:|:..|. ..|.....||.....|.|                 .:..|..::|..|.|..
Zfish   609 --EIDAEAQTSAPDECQSAYGGQSGVKLPATISERHVHDLKHWSTASRAVETSSSKAQDDLSNTQ 671

  Fly   665 PPLPSFKSKVFNAEMIKINIPKPE 688
            ....|:..|.....::..|...||
Zfish   672 TSHSSWPWKHTEINLVDQNTQGPE 695

Known Domains:


GeneSequenceDomainRegion External IDIdentity
frtzNP_001259879.1 DUF3312 47..596 CDD:288601 154/584 (26%)
WD40 <308..384 CDD:295369 18/76 (24%)
wdpcpXP_005158592.1 DUF3312 47..603 CDD:288601 155/590 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C257096952
eggNOG 1 0.900 E1_28IXA
Hieranoid 1 1.000
Homologene 1 1.000 H9299
Inparanoid 1 1.050 173 1.000 Inparanoid score I4009
OMA 1 1.010
OrthoDB 1 1.010 D306370at33208
OrthoFinder 1 1.000 FOG0006940
OrthoInspector 1 1.000 T1053909
orthoMCL 1 0.900 OOG5_135344
Panther 1 1.100 LDO PTHR13667
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R7664
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.890

Return to query results.
Submit another query.