DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpL48 and mrpl48

Sequence 1:NP_001259878.1 Gene:mRpL48 FlyBaseID:FBgn0031357 Length:181 Species:Drosophila melanogaster
Sequence 2:XP_017945434.1 Gene:mrpl48 XenbaseID:XB-GENE-997534 Length:219 Species:Xenopus tropicalis

Alignment Length:144 Identity:43/145 (30%)
Similarity:71/145 (49%) Gaps:12/145 (8%)


  Fly    32 EPDYLESLKPKFP----------QYESLNVQIKGYDYPQLESYQRFLHGLAEYLDLDVSDCYALP 86
            |||  ...|.|.|          :|..||:|:.||:...:|.|.:::|.|...|.:.|.:|||.|
 Frog    73 EPD--PKKKDKLPSKAIKANSEHEYGVLNLQLSGYNMVLVEHYSQYVHNLCNRLSIKVQECYAKP 135

  Fly    87 PQKTTVQRLRPNSTVIESEYKLTTYERNLQLNNVDAPVYPQFLRLAQAALPEGVSLQVQEYTDDC 151
            .:...|..::.:||.:..:..||.:||.:|:..:.|.:.|..:.:.....||||.|.|:|:.:..
 Frog   136 TKTKEVLLMQEHSTKMFLDSVLTVHERVVQVTGLSATMAPILMEVLMMNQPEGVQLLVKEHAEAD 200

  Fly   152 EERRYVPDKELLDL 165
            .:.|:....||..|
 Frog   201 YQVRFKTRPELESL 214

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL48NP_001259878.1 Ribosomal_S10 50..144 CDD:278753 29/94 (31%)
mrpl48XP_017945434.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C173033661
eggNOG 1 0.900 E1_KOG4060
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1522619at2759
OrthoFinder 1 1.000 FOG0006436
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.710

Return to query results.
Submit another query.