DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL48 and mrpl48

DIOPT Version :10

Sequence 1:NP_608613.1 Gene:mRpL48 / 33348 FlyBaseID:FBgn0031357 Length:181 Species:Drosophila melanogaster
Sequence 2:XP_017945434.1 Gene:mrpl48 / 100379781 XenbaseID:XB-GENE-997534 Length:219 Species:Xenopus tropicalis


Alignment Length:144 Identity:43/144 - (29%)
Similarity:71/144 - (49%) Gaps:12/144 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EPDYLESLKPKFP----------QYESLNVQIKGYDYPQLESYQRFLHGLAEYLDLDVSDCYALP 86
            |||  ...|.|.|          :|..||:|:.||:...:|.|.:::|.|...|.:.|.:|||.|
 Frog    73 EPD--PKKKDKLPSKAIKANSEHEYGVLNLQLSGYNMVLVEHYSQYVHNLCNRLSIKVQECYAKP 135

  Fly    87 PQKTTVQRLRPNSTVIESEYKLTTYERNLQLNNVDAPVYPQFLRLAQAALPEGVSLQVQEYTDDC 151
            .:...|..::.:||.:..:..||.:||.:|:..:.|.:.|..:.:.....||||.|.|:|:.:..
 Frog   136 TKTKEVLLMQEHSTKMFLDSVLTVHERVVQVTGLSATMAPILMEVLMMNQPEGVQLLVKEHAEAD 200

  Fly   152 EERRYVPDKELLDL 165
            .:.|:....||..|
 Frog   201 YQVRFKTRPELESL 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL48NP_608613.1 Ribosomal_S10 50..144 CDD:459769 29/93 (31%)
mrpl48XP_017945434.1 Ribosomal_S10 99..194 CDD:459769 29/94 (31%)

Return to query results.
Submit another query.