DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL48 and mrpl48

DIOPT Version :9

Sequence 1:NP_001259878.1 Gene:mRpL48 / 33348 FlyBaseID:FBgn0031357 Length:181 Species:Drosophila melanogaster
Sequence 2:XP_017945434.1 Gene:mrpl48 / 100379781 XenbaseID:XB-GENE-997534 Length:219 Species:Xenopus tropicalis


Alignment Length:144 Identity:43/144 - (29%)
Similarity:71/144 - (49%) Gaps:12/144 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EPDYLESLKPKFP----------QYESLNVQIKGYDYPQLESYQRFLHGLAEYLDLDVSDCYALP 86
            |||  ...|.|.|          :|..||:|:.||:...:|.|.:::|.|...|.:.|.:|||.|
 Frog    73 EPD--PKKKDKLPSKAIKANSEHEYGVLNLQLSGYNMVLVEHYSQYVHNLCNRLSIKVQECYAKP 135

  Fly    87 PQKTTVQRLRPNSTVIESEYKLTTYERNLQLNNVDAPVYPQFLRLAQAALPEGVSLQVQEYTDDC 151
            .:...|..::.:||.:..:..||.:||.:|:..:.|.:.|..:.:.....||||.|.|:|:.:..
 Frog   136 TKTKEVLLMQEHSTKMFLDSVLTVHERVVQVTGLSATMAPILMEVLMMNQPEGVQLLVKEHAEAD 200

  Fly   152 EERRYVPDKELLDL 165
            .:.|:....||..|
 Frog   201 YQVRFKTRPELESL 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL48NP_001259878.1 Ribosomal_S10 50..144 CDD:278753 29/93 (31%)
mrpl48XP_017945434.1 Ribosomal_S10 99..194 CDD:366038 29/94 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10624
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5162
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522619at2759
OrthoFinder 1 1.000 - - FOG0007045
OrthoInspector 1 1.000 - - oto104384
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.