DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cpb and CAPZB

Sequence 1:NP_001259877.1 Gene:cpb FlyBaseID:FBgn0011570 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_011540530.1 Gene:CAPZB HGNCID:1491 Length:306 Species:Homo sapiens

Alignment Length:276 Identity:213/277 (77%)
Similarity:244/277 (88%) Gaps:2/277 (1%)


  Fly     2 SEMQMDCALDLMRRLPPQQIEKNLIDLIDLAPDLCEDLLSSVDQPLKIAKDKEHGKDYLLCDYNR 66
            |:.|:|||||||||||||||||||.|||||.|.||||||||||||||||:||..|||||||||||
Human    31 SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNR 95

  Fly    67 DGDSYRSPWSNSYYPPLEDGQMPSERLRKLEIEANYAFDQYREMYYEGGVSSVYLWDLDHGFAAV 131
            |||||||||||.|.||||||.|||.||||||:|||.||||||::|:|||||||||||||||||.|
Human    96 DGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGV 160

  Fly   132 ILIKKAGDGSKMIRGCWDSIHVVEVQEKTTGRTAHYKLTSTAMLWLQTNKQGSGTMNLGGSLTRQ 196
            |||||||||||.|:||||||||||||||::|||||||||||.||||||||.||||||||||||||
Human   161 ILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQ 225

  Fly   197 QEQDANVSESSPHIANIGKMVEEMENKIRNTLNEIYFGKTKDIVNGLRSTQSLADQRQQAAMKQD 261
            .|:|..||:.||||||||::||:||||||:|||||||||||||||||||..::.|.::...::::
Human   226 MEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPDNQKFKQLQRE 290

  Fly   262 LAAAILRRN--VKPES 275
            |:..:.:|.  ::|::
Human   291 LSQVLTQRQIYIQPDN 306

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cpbNP_001259877.1 F_actin_cap_B 11..239 CDD:279459 196/228 (86%)
CAPZBXP_011540530.1 F_actin_cap_B 40..268 CDD:279459 196/228 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C165836408
eggNOG 1 0.900 E1_KOG3174
Hieranoid 1 1.000
Homologene 1 1.000 H3620
Inparanoid 1 1.050 448 1.000 Inparanoid score I1604
Isobase 1 0.950 0 Normalized mean entropy S406
OMA 1 1.010
OrthoDB 1 1.010 D1076134at2759
OrthoFinder 1 1.000 FOG0003698
OrthoInspector 1 1.000 T1072690
orthoMCL 1 0.900 OOG5_128870
Panther 1 1.100 LDO PTHR10619
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4497
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.