DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a5 and PEBP1

DIOPT Version :8

Sequence 1:NP_476998.1 Gene:a5 / 33317 FlyBaseID:FBgn0011294 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_002558.1 Gene:PEBP1 / 5037 HGNCID:8630 Length:187 Species:Homo sapiens

Alignment Length:170 Identity:71/171 (42%)
Similarity:103/171 (60%) Gaps:2/171 (1%)


  Fly    40 LDEPPRELLRIKYDNTIDIEEGKTYTPTELKFQP-RLDWNA-DPESFYTVLMICPDAPNRENPMY 102
            :||.|:..|.:.|......|.||..|||::|.:| .:.|:. |....||:::..||||:|::|.|
Human    17 VDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKY 81

  Fly   103 RSWLHWLVVNVPGLDIMKGQPISEYFGPLPPKDSGIQRYLILVYQQSDKLDFDEKKMELSNADGH 167
            |.|.|:||||:.|.||..|..:|:|.|..|||.:|:.||:.|||:|...|..||..:...:.|..
Human    82 REWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHR 146

  Fly   168 SNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPELMKTLYG 207
            ..|.|..|.:|||:.:||||..:|:.||:|||:|.:.|.|
Human   147 GKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSG 186

Known Domains:


GeneSequenceDomainRegion External IDIdentity
a5NP_476998.1 PEBP_euk 47..192 CDD:176644 60/147 (41%)
PEBP1NP_002558.1 PEBP_euk 23..171 CDD:176644 60/148 (41%)
Interaction with RAF1. {ECO:0000269|PubMed:18294816} 93..134 18/41 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86928180
eggNOG 1 0.900 E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 1 1.000 FOG0000385
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11362
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.