DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a5 and SPBC2F12.10

DIOPT Version :8

Sequence 1:NP_476998.1 Gene:a5 / 33317 FlyBaseID:FBgn0011294 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001342831.1 Gene:SPBC2F12.10 / 2540365 PomBaseID:SPBC2F12.10 Length:308 Species:Schizosaccharomyces pombe

Alignment Length:216 Identity:51/217 (24%)
Similarity:92/217 (42%) Gaps:28/217 (13%)


  Fly    13 FICLARSQDNDENVRRIMKEMEVIPEILD------EPPREL-LRIKYDNTIDIEEGKTYTPTELK 70
            |:.:.:.|..|.....:::.:|.:..|.|      .|..:: |....:|...|..| |..|:.:.
pombe    92 FLYMLKQQWEDYQKLLLLQRLEQMKVIKDSGIGSFSPSVDVQLGFNPENNDSITPG-TILPSTVT 155

  Fly    71 FQPR----LDWNADPESFYTVLMICPDAPNRENPMYRSWLHWLVVNVPGLDIMKGQPIS------ 125
            .:..    |.:|. .::.|:|:.:..|.||.|...:.:..:||:.|:| ::..|..||.      
pombe   156 VKTPWLSVLPFNC-KKNHYSVITLDLDVPNYETNRFETHCNWLLTNIP-IEASKRVPIDTSKAFF 218

  Fly   126 EYFGPLPPKDSGIQRYLILVY-QQSDKLDFDEKKMELSNADGHSNFDVMKFTQKYEMGSPVAGNI 189
            :|..|:..:.....|.|.||. |:|..:...      |||.....||:.:|...|:: .||..::
pombe   219 QYRPPIVHRGEDKHRILTLVLRQKSSSISIP------SNALVRERFDLSEFCSIYDL-EPVGAHL 276

  Fly   190 FQSRWDEYVPELMKTLYGVSE 210
            ::|.||.....|:.....|.|
pombe   277 WRSGWDSDAVALLSKHPSVHE 297

Known Domains:


GeneSequenceDomainRegion External IDIdentity
a5NP_476998.1 PEBP_euk 47..192 CDD:176644 38/157 (24%)
SPBC2F12.10NP_001342831.1 PEBP_euk 130..279 CDD:176644 38/159 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000385
OrthoInspector 1 1.000 T1124529
orthoMCL 1 0.900 OOG5_135348
Panther 1 1.100 O PTHR11362
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.