DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5001 and YDJ1

Sequence 1:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_014335.1 Gene:YDJ1 SGDID:S000005008 Length:409 Species:Saccharomyces cerevisiae

Alignment Length:405 Identity:123/406 (30%)
Similarity:183/406 (45%) Gaps:125/406 (31%)


  Fly     5 YYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYDKYGE 69
            :|.|||:|.||||.||||||||.||:||||||.:..|.:||||.:.|||:|||..||::||::||
Yeast     7 FYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEASAAYEILSDPEKRDIYDQFGE 71

  Fly    70 DGLKSGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTEPDFF 134
            |||...|...|.|...                           |..||::|.:          ||
Yeast    72 DGLSGAGGAGGFPGGG---------------------------FGFGDDIFSQ----------FF 99

  Fly   135 SSPFGGIGSRHGLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGCVKKMKISR 199
                       |.|...||              :..::...::|::..:|||:|.|...|:.:::
Yeast   100 -----------GAGGAQRP--------------RGPQRGKDIKHEISASLEELYKGRTAKLALNK 139

  Fly   200 RIV--QADGSSRK---------------------------------------------------- 210
            :|:  :.:|...|                                                    
Yeast   140 QILCKECEGRGGKKGAVKKCTSCNGQGIKFVTRQMGPMIQRFQTECDVCHGTGDIIDPKDRCKSC 204

  Fly   211 -------EEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFIIRDKPHAMFKREGSDLRYT 268
                   |.|.|.:.::||.|.|.::.|:.|.||||..||.|:|||:.::||..|||:|.||.|.
Yeast   205 NGKKVENERKILEVHVEPGMKDGQRIVFKGEADQAPDVIPGDVVFIVSERPHKSFKRDGDDLVYE 269

  Fly   269 ARLTLKQALCGVVFQVPTMSGDKLRISTMQ-EIIKPNTVKRIQGYGLPFPKDTTRKGDLLVAFDI 332
            |.:.|..|:.|..|.:..:|||.|::..:. |:|.|...|.|:|.|:|.|| ....|:|::.|.|
Yeast   270 AEIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPIPK-YGGYGNLIIKFTI 333

  Fly   333 QFPEKLTAAQKEVLK 347
            :|||....:::.:.|
Yeast   334 KFPENHFTSEENLKK 348

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 122/404 (30%)
DnaJ 4..65 CDD:278647 39/60 (65%)
DnaJ_C 174..338 CDD:199909 64/226 (28%)
YDJ1NP_014335.1 DnaJ 2..368 CDD:223560 123/406 (30%)
DnaJ 7..67 CDD:278647 39/60 (65%)
DnaJ_C 114..338 CDD:199909 64/225 (28%)
DnaJ_zf 143..208 CDD:199908 2/65 (3%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.