DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5001 and AT5G49580

Sequence 1:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001318769.1 Gene:AT5G49580 AraportID:AT5G49580 Length:695 Species:Arabidopsis thaliana

Alignment Length:264 Identity:68/265 (26%)
Similarity:95/265 (36%) Gaps:78/265 (29%)


  Fly     4 DYYKILGLPKTATDD--EIKKAYRKLALRYHPDKNKA-ANAEDKFKEVAEAYEVLSDKSKREVYD 65
            |:|..|||.:....|  .:|:.|||.|:..|||||.. ..|.:.||::..|||||.|..|::.||
plant   408 DHYSALGLARYGNVDMAYLKREYRKKAMLVHPDKNMGNERAAEAFKKLQNAYEVLLDSVKQKSYD 472

  Fly    66 KYGEDGLKSGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTE 130
                |.||.....|                   :.:.|.||:                  ..||.
plant   473 ----DELKREELLN-------------------YFRRFQNSS------------------QKDTR 496

  Fly   131 PDFFSSPFGGIGSRHGLGSGFRPSFR-------SHSFNVHTPF--KKEQK-----QDPPVEH--- 178
            ...||.  .|.||..|.|   ..:||       ....|:|..|  ||.:.     ||....|   
plant   497 GHGFSG--SGFGSSEGEG---EEAFRECRQIACKKCGNLHAWFLTKKSKSTARWCQDCKEFHQAK 556

  Fly   179 --DLYV--TLEEIYHGCVKKMKISRRIVQADGSSRKEEKFL--------AISIKPGWKSGTKVTF 231
              |.:|  ..:.:..|..:|:.:.|..|.||....:..::.        |.:.||.:......|.
plant   557 DGDGWVEQASQHVLFGLFQKVDMPRAYVCADSKIYEASQWYICQGMRCPANTHKPSFHVNMNATA 621

  Fly   232 QKEG 235
            .|.|
plant   622 AKRG 625

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 68/265 (26%)
DnaJ 4..65 CDD:278647 27/64 (42%)
DnaJ_C 174..338 CDD:199909 15/78 (19%)
AT5G49580NP_001318769.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24078
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.