DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5001 and AT5G25530

Sequence 1:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_197935.1 Gene:AT5G25530 AraportID:AT5G25530 Length:347 Species:Arabidopsis thaliana

Alignment Length:371 Identity:152/372 (41%)
Similarity:208/372 (56%) Gaps:47/372 (13%)


  Fly     1 MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDK--NKAANAEDKFKEVAEAYE--------VL 55
            ||.|||.||.:.:.||:|::||:|||||:::||||  |....||.|||:::||||        ||
plant     1 MGLDYYDILKVNRNATEDDLKKSYRKLAMKWHPDKNPNTKTEAEAKFKQISEAYEAKYEVMFQVL 65

  Fly    56 SDKSKREVYDKYGEDGLKS----GGTRNGGPSSNSFTYQFHGDPRAT---FAQFFGNSNPFASFF 113
            ||..||.|||:|||:||..    |.|.|.|.:...       :||..   ||:||| |:||.  |
plant    66 SDPQKRAVYDQYGEEGLSDMPPPGSTGNNGRAGGF-------NPRNAEDIFAEFFG-SSPFG--F 120

  Fly   114 DMGDNLFDKKVFDLDTEPDFFSSPFGGIGSRHGLGSGFRPS----FRSHSFNVHTPFKKEQKQDP 174
            ...........|..|          ||.|...|.|.|...|    ||::|.....|     |:.|
plant   121 GSAGGPGRSMRFQSD----------GGGGMFGGFGGGNNGSENNIFRTYSEGTPAP-----KKPP 170

  Fly   175 PVEHDLYVTLEEIYHGCVKKMKISRRIVQADGSSRKEEKFLAISIKPGWKSGTKVTFQKEGDQAP 239
            |||..|..:|||:|.|..:||||||.||.|:|...:|.:.|.|.:|||||.|||:.|..:|::..
plant   171 PVESKLPCSLEELYSGSTRKMKISRSIVDANGRQAQETEILTIVVKPGWKKGTKIKFPDKGNEQV 235

  Fly   240 GKIPADIVFIIRDKPHAMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEIIKPN 304
            .::|||:||:|.:|||.:|.|:|:||..:.|:||.:|:.|....:.|:.|..|.:. :.||:.|.
plant   236 NQLPADLVFVIDEKPHDLFTRDGNDLITSRRVTLAEAIGGTTVNINTLDGRNLPVG-VAEIVSPG 299

  Fly   305 TVKRIQGYGLPFPKDTTRKGDLLVAFDIQFPEKLTAAQKEVLKDML 350
            ....:.|.|:|..|:...||||.:.||:|||.:||..||..||.:|
plant   300 YEFVVPGEGMPIAKEPRNKGDLKIKFDVQFPARLTTEQKSALKRVL 345

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 150/367 (41%)
DnaJ 4..65 CDD:278647 37/71 (52%)
DnaJ_C 174..338 CDD:199909 71/164 (43%)
AT5G25530NP_197935.1 DnaJ 1..342 CDD:223560 150/367 (41%)
DnaJ 4..75 CDD:278647 37/71 (52%)
DnaJ_C 170..333 CDD:199909 71/164 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 263 1.000 Inparanoid score I931
OMA 1 1.010
OrthoDB 1 1.010 D1393097at2759
OrthoInspector 1 1.000 T32245
orthoMCL 1 0.900 OOG5_126773
Panther 1 1.100 O PTHR24078
Phylome 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.