DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5001 and AT5G01390

Sequence 1:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_195759.1 Gene:AT5G01390 AraportID:AT5G01390 Length:335 Species:Arabidopsis thaliana

Alignment Length:367 Identity:147/368 (40%)
Similarity:210/368 (57%) Gaps:51/368 (14%)


  Fly     1 MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDK--NKAANAEDKFKEVAEAYEVLSDKSKREV 63
            ||.|:||:|.:.::|.|||:||||||||:::||||  |....||.|||:::|||:||||..||.:
plant     1 MGVDFYKVLEVDRSANDDELKKAYRKLAMKWHPDKNPNNKKEAEAKFKQISEAYDVLSDPQKRAI 65

  Fly    64 YDKYGEDGLKSG---GTRNGGPSSNSFTYQFHGDPRAT---FAQFFGNSNPFASFFDMGDNLFDK 122
            |::|||:||...   |...|.|..:.....|..:||:.   |::|||                  
plant    66 YEQYGEEGLNQAPPPGAGGGYPGGSDAGASFRFNPRSADDIFSEFFG------------------ 112

  Fly   123 KVFDLDTEPDFFSSPFGGIGSRHGLG-SGFR------PSFRSHSF--NVHTPFKKEQKQDPPVEH 178
                       |:.|..|.||....| ||||      .|||:.:.  ....|.:|    ..|:|.
plant   113 -----------FTRPSFGTGSDSRAGPSGFRYGDDIFASFRAATTGGEASIPSRK----SAPIER 162

  Fly   179 DLYVTLEEIYHGCVKKMKISRRIVQADGSSRKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIP 243
            .|..:||::|.|..|||||||.::.:.|.....|:.|.|.||||||.|||:||.::|::..|.||
plant   163 QLPCSLEDLYKGVSKKMKISRDVLDSSGRPTPVEEILTIEIKPGWKKGTKITFLEKGNEHRGVIP 227

  Fly   244 ADIVFIIRDKPHAMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEIIKPNTVKR 308
            :|:|||:.:|||.:|||:|:||....:::|..||.|...||.|:.|..|.: .:..:|.|:..:.
plant   228 SDLVFIVDEKPHPVFKRDGNDLVVMQKISLVDALTGYTAQVTTLDGRTLTV-PVNNVISPSYEEV 291

  Fly   309 IQGYGLPFPKDTTRKGDLLVAFDIQFPEKLTAAQKEVLKDML 350
            ::|.|:|.|||.:|||:|.:.|.|:||.|||..||..:|.||
plant   292 VKGEGMPIPKDPSRKGNLRIRFIIKFPSKLTTEQKSGIKRML 333

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 144/363 (40%)
DnaJ 4..65 CDD:278647 36/63 (57%)
DnaJ_C 174..338 CDD:199909 72/164 (44%)
AT5G01390NP_195759.1 DnaJ 1..326 CDD:223560 143/359 (40%)
DnaJ 4..67 CDD:278647 36/63 (57%)
DnaJ_C 158..321 CDD:199909 72/164 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 263 1.000 Inparanoid score I931
OMA 1 1.010
OrthoDB 1 1.010 D1393097at2759
OrthoInspector 1 1.000 T32245
orthoMCL 1 0.900 OOG5_126773
Panther 1 1.100 O PTHR24078
Phylome 1 0.910 0.952 Consistency score
87.980

Return to query results.
Submit another query.