DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5001 and AT3G47940

Sequence 1:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_190377.1 Gene:AT3G47940 AraportID:AT3G47940 Length:350 Species:Arabidopsis thaliana

Alignment Length:355 Identity:149/356 (42%)
Similarity:212/356 (60%) Gaps:14/356 (4%)


  Fly     1 MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAA---NAEDKFKEVAEAYEVLSDKSKRE 62
            ||.|||.||.:...||:|::||||::||:.:|||||.:.   .||.|||.::|||:||||..||:
plant     1 MGVDYYNILKVNHNATEDDLKKAYKRLAMIWHPDKNPSTRRDEAEAKFKRISEAYDVLSDPQKRQ 65

  Fly    63 VYDKYGEDGLKSGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDL 127
            :||.|||:|||||...|...|..|.:..........|.|......|.||.|..  |..|.:    
plant    66 IYDLYGEEGLKSGKIPNSSSSEASSSSSSSSSRYPHFHQHRPQHPPNASSFRF--NPRDAE---- 124

  Fly   128 DTEPDFFSSPFGGIGSRHGLGSGFRPSFRSHSFNV--HTPFKKEQKQDPPVEHDLYVTLEEIYHG 190
            |...:||.|..|| ||.:..|.|.| :||:..||.  ...:..|.::.|.:|:.|.|:||::|.|
plant   125 DIYAEFFGSENGG-GSNNAGGRGNR-AFRNGHFNTGGANGYSGEMRKVPAMENPLPVSLEDLYKG 187

  Fly   191 CVKKMKISRRIVQADGSSRKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFIIRDKPH 255
            .||||:|:|.:..|.|....|.:.|.|.||||||.|||:||.|:|::.||.|||||||::.:|||
plant   188 VVKKMRITRNVYDASGRMMVEAEILPIEIKPGWKKGTKLTFPKKGNEEPGIIPADIVFVVEEKPH 252

  Fly   256 AMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEIIKPNTVKRIQGYGLPFPKDT 320
            .::||:|:||..:..:||.:||.|....:.|:.|..|.| .:.|||||:....:...|:|..|:.
plant   253 PVYKRDGNDLLVSQEITLLEALTGKTVNLITLDGRTLMI-PLTEIIKPDHEIVVPNEGMPISKEP 316

  Fly   321 TRKGDLLVAFDIQFPEKLTAAQKEVLKDML 350
            .:||:|.:...:::|.:||:.||..||.:|
plant   317 GKKGNLKLKLSVKYPSRLTSDQKFELKRVL 346

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 147/351 (42%)
DnaJ 4..65 CDD:278647 34/64 (53%)
DnaJ_C 174..338 CDD:199909 70/164 (43%)
AT3G47940NP_190377.1 DnaJ 1..344 CDD:223560 148/352 (42%)
DnaJ 4..68 CDD:278647 34/64 (53%)
DnaJ_C 176..334 CDD:199909 68/159 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 263 1.000 Inparanoid score I931
OMA 1 1.010
OrthoDB 1 1.010 D1393097at2759
OrthoInspector 1 1.000 T32245
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24078
Phylome 1 0.910 0.952 Consistency score
77.080

Return to query results.
Submit another query.