DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5001 and AT2G20550

Sequence 1:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001031380.1 Gene:AT2G20550 AraportID:AT2G20550 Length:284 Species:Arabidopsis thaliana

Alignment Length:335 Identity:109/336 (32%)
Similarity:163/336 (49%) Gaps:70/336 (21%)


  Fly    32 HPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYDKYGEDGLKSGGTRNGGPSSNSFTYQFHGDPR 96
            ||     .||:|.|.|.                         .|.:|..|||.          ||
plant     3 HP-----RNADDIFSEF-------------------------FGVSRPSGPSG----------PR 27

  Fly    97 AT---FAQFFGNSNP---------FASFFDMGDNLFDKKVFDLDTEPDFFSSP----FGGIGSRH 145
            ..   :::|||.|:|         |:.||::.:....:...|:..|  :|..|    .|..|.|.
plant    28 NADDIYSEFFGVSSPSGPRNKDDIFSEFFEVSNPSGPRDKDDISAE--YFGVPSPSGSGSSGGRE 90

  Fly   146 GLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGCVKKMKISRRIVQADGSSRK 210
            |.|.|           ..|......::..|||..|..:||::|.|..|||||||.|....|.:.:
plant    91 GGGGG-----------GGTMHHGGARKAAPVEKKLPCSLEDLYKGTTKKMKISREIAGVFGKTTQ 144

  Fly   211 EEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFIIRDKPHAMFKREGSDLRYTARLTLKQ 275
            .::.|.:.:|||||:|||:||.::|::.||.||||:||||.:|||.:|.|||:||..|.::::.:
plant   145 VQEILTVDVKPGWKTGTKITFSEKGNEQPGVIPADLVFIIDEKPHPVFTREGNDLVVTQKISVLE 209

  Fly   276 ALCGVVFQVPTMSGDKLRISTMQEIIKPNTVKRIQGYGLPFPKDTTRKGDLLVAFDIQFPEKLTA 340
            |..|....:.|:.|.:|.| .:..:|.|..|:.:...|:|..||..:||:|.:.|:|:||..||:
plant   210 AFTGYTVNLTTLDGRRLTI-PVNTVIHPEYVEVVPNEGMPLQKDQAKKGNLRIKFNIKFPTTLTS 273

  Fly   341 AQKEVLKDML 350
            .||..||.:|
plant   274 EQKTGLKKLL 283

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 107/331 (32%)
DnaJ 4..65 CDD:278647 7/33 (21%)
DnaJ_C 174..338 CDD:199909 69/164 (42%)
AT2G20550NP_001031380.1 DnaJ_C 108..271 CDD:199909 69/164 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 263 1.000 Inparanoid score I931
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1393097at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24078
Phylome 1 0.910 0.968 Consistency score
44.070

Return to query results.
Submit another query.