DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5001 and dnajb13

Sequence 1:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001072920.1 Gene:dnajb13 XenbaseID:XB-GENE-996716 Length:316 Species:Xenopus tropicalis

Alignment Length:357 Identity:160/358 (45%)
Similarity:215/358 (60%) Gaps:50/358 (14%)


  Fly     1 MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYD 65
            ||:|||.:|.:..:|.|.:||||||||||:|||.|||..:|..:||::||||:||||..|:..||
 Frog     1 MGQDYYSVLEITPSAGDSDIKKAYRKLALKYHPLKNKEPSAPHRFKQIAEAYDVLSDLRKKATYD 65

  Fly    66 KYGEDGLKSG-GTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDT 129
            |:||:|||.| ....||..:.:..|.|||:|..||.:|||..||||.||                
 Frog    66 KFGEEGLKGGVPPEFGGEEAWTSGYVFHGNPDRTFNEFFGGDNPFADFF---------------- 114

  Fly   130 EPDFFSSPFG-----GIGSRHGLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYH 189
                  :|.|     |.|...|.|.                    :.||||:|.|||::||:::.
 Frog   115 ------TPTGSEVNTGFGGLRGRGM--------------------KTQDPPIERDLYLSLEDLFF 153

  Fly   190 GCVKKMKISRRIVQADG-SSRKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFIIRDK 253
            ||.||:|||||::..|| :|...:|.|:|..:|||:.|||:|||.||||.|..|||||:||:|:|
 Frog   154 GCTKKIKISRRVMNDDGHTSSIRDKILSIDARPGWREGTKITFQNEGDQGPNIIPADIIFIVREK 218

  Fly   254 PHAMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEIIKPNTVKRIQGYGLPFPK 318
            ||..|||:|:||.|||.:.|.:||.|...:|.|:....|.| .:.:|:.|...|.:.|.|:..||
 Frog   219 PHPRFKRQGNDLIYTANIELGKALTGCTVEVETLDERLLNI-PINDIVHPTYRKVVPGEGMRLPK 282

  Fly   319 DTTRKGDLLVAFDIQFPEKLTAAQKEVLKDML 350
            |.|.||||::.|||.|||.||..:|::|:..|
 Frog   283 DPTLKGDLIIQFDIHFPEHLTPQKKQLLRKAL 314

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 159/353 (45%)
DnaJ 4..65 CDD:278647 35/61 (57%)
DnaJ_C 174..338 CDD:199909 84/165 (51%)
dnajb13NP_001072920.1 DnaJ 1..312 CDD:223560 159/354 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1393097at2759
OrthoFinder 1 1.000 FOG0000281
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.