DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5001 and zgc:122979

Sequence 1:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001032663.2 Gene:zgc:122979 ZFINID:ZDB-GENE-051127-45 Length:360 Species:Danio rerio

Alignment Length:352 Identity:136/353 (39%)
Similarity:204/353 (58%) Gaps:50/353 (14%)


  Fly     4 DYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYDKYG 68
            |||.:||:...:.::||:|||::||||||||||..|:||||||::|:||:||:|..||.:||   
Zfish    51 DYYSVLGVSNDSNEEEIRKAYKRLALRYHPDKNSDADAEDKFKQIAQAYDVLTDPEKRNIYD--- 112

  Fly    69 EDGLKSGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTEPDF 133
            :.||..||.   .|:.|.      .||.       .||...|..:.|..|      ||||::.|.
Zfish   113 QQGLTKGGV---APTCNK------TDPS-------HNSKADAHSWHMFFN------FDLDSDDDL 155

  Fly   134 FS----SPFGGIGSRHGLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGCVKK 194
            |:    :|...:...||...|.:|:                 .|..| |||.|:||:|..|..|:
Zfish   156 FNPFTRNPLPHLSRHHGNKGGLKPA-----------------GDAEV-HDLSVSLEDILMGVTKR 202

  Fly   195 MKISRRIVQADGSSRK-EEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFIIRDKPHAMF 258
            :|:: |:.|.|..:.| ||:...:.:|.|||.||::||..||.|..|..|.|:.|:|::|.||.|
Zfish   203 VKLT-RLRQTDKHTLKPEERVFDVEVKKGWKEGTRITFPNEGHQMLGHAPNDLAFVIKEKKHAHF 266

  Fly   259 KREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEIIKPNTVKRIQGYGLPFPKDTTRK 323
            :|:||.:.||..:||::||||....|||:.| :::.....::|||::|:|:.|.|||..|:..::
Zfish   267 RRDGSHIVYTCTITLREALCGCTVNVPTLDG-QMKPLPCSDVIKPSSVRRLIGEGLPRAKNPAQR 330

  Fly   324 GDLLVAFDIQFPEKLTAAQKEVLKDML 350
            |||||.|.:.||:::..:.||::|..|
Zfish   331 GDLLVEFQVVFPDRIPPSSKEIIKHSL 357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 134/348 (39%)
DnaJ 4..65 CDD:278647 36/61 (59%)
DnaJ_C 174..338 CDD:199909 70/165 (42%)
zgc:122979NP_001032663.2 DnaJ 50..355 CDD:223560 135/349 (39%)
DnaJ 51..112 CDD:278647 36/61 (59%)
DnaJ_C 185..345 CDD:199909 70/163 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116976456
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1393097at2759
OrthoFinder 1 1.000 FOG0000281
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24078
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.