DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5001 and dnajb13

Sequence 1:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001017606.1 Gene:dnajb13 ZFINID:ZDB-GENE-040910-4 Length:322 Species:Danio rerio

Alignment Length:356 Identity:150/357 (42%)
Similarity:209/357 (59%) Gaps:48/357 (13%)


  Fly     1 MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYD 65
            ||:|||.||.:.:.|.|.:||||||:|||::||..|..|.|.::|..:|||::||||..|:..||
Zfish     1 MGRDYYAILEINRNAIDADIKKAYRRLALKHHPRSNSHARAAERFNLLAEAFDVLSDPRKKATYD 65

  Fly    66 KYGEDGLKSG-----GTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVF 125
            |:||:|||.|     |. ||..||.   |.:||:...||.||||..||||.|| .||        
Zfish    66 KFGEEGLKGGIPSELGV-NGAWSSG---YVYHGNADETFRQFFGGDNPFADFF-TGD-------- 117

  Fly   126 DLDTEPDFFSSPFGGIGSRHGLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHG 190
                                  |:....:|.|      ...:||:.||||:|.||::.||::|:|
Zfish   118 ----------------------GNEVNAAFES------LRGRKEKLQDPPIERDLHLALEDLYYG 154

  Fly   191 CVKKMKISRRIVQADG-SSRKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFIIRDKP 254
            |.||:|||||::..|| :|...:|.|..::|.||..||::||.|||||.|..|||||||:||.|.
Zfish   155 CTKKIKISRRVMNEDGHTSSIRDKILTFTVKAGWNEGTRITFPKEGDQGPNNIPADIVFVIRQKN 219

  Fly   255 HAMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEIIKPNTVKRIQGYGLPFPKD 319
            |..|.|:..||.||..::|::||.|...:|.|:.|..|.| .:.:|:.|...|.:.|.|:|....
Zfish   220 HPRFVRQNDDLFYTEHISLEKALTGFSVEVETLDGRLLNI-PINDIVHPQYTKVVSGEGMPLSNS 283

  Fly   320 TTRKGDLLVAFDIQFPEKLTAAQKEVLKDML 350
            .:::|||::.|...|||||:|.:|::|:..|
Zfish   284 PSKRGDLIIRFITHFPEKLSAEKKKLLRGAL 314

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 149/352 (42%)
DnaJ 4..65 CDD:278647 31/61 (51%)
DnaJ_C 174..338 CDD:199909 75/165 (45%)
dnajb13NP_001017606.1 DnaJ 1..311 CDD:223560 149/352 (42%)
DnaJ 4..65 CDD:278647 31/61 (51%)
DnaJ_C 138..302 CDD:199909 75/165 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1393097at2759
OrthoFinder 1 1.000 FOG0000281
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126773
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.