DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5001 and dnajb5

Sequence 1:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001093510.1 Gene:dnajb5 ZFINID:ZDB-GENE-070705-308 Length:360 Species:Danio rerio

Alignment Length:369 Identity:186/370 (50%)
Similarity:248/370 (67%) Gaps:31/370 (8%)


  Fly     1 MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYD 65
            ||||||||||:|..:.:|||||||||:||::||||||..|||:||||:|||||||||..||.:||
Zfish     1 MGKDYYKILGIPSGSNEDEIKKAYRKMALKFHPDKNKDPNAEEKFKEIAEAYEVLSDPKKRVIYD 65

  Fly    66 KYGEDGLKSGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFF-------------DMGD 117
            :|||||||:|||.:......::.|.|||||.||||.|||.||||..||             |.||
Zfish    66 QYGEDGLKTGGTGSSSGQGTTYHYTFHGDPHATFASFFGGSNPFDIFFGSSRQRGNTNGFPDHGD 130

  Fly   118 NLFDKKVFDLDTEPDFFSS----PFGGI-GSRHGLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVE 177
            :..|   .|:|.|.|.|||    .|.|: |..||.|.      |..:..:|...||  .|||||.
Zfish   131 HDMD---IDMDGEDDPFSSFSHFGFNGVNGFHHGGGR------RHRNEPLHGGRKK--LQDPPVV 184

  Fly   178 HDLYVTLEEIYHGCVKKMKISRRIVQADGSS-RKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGK 241
            |:|.|:||||:|||.|:|:|:||.:..|..: |.|:|.|.|.||.|||.|||:||.||||:.|..
Zfish   185 HELKVSLEEIFHGCTKRMRITRRRLNPDRKTMRTEDKILNIVIKRGWKEGTKITFPKEGDETPEN 249

  Fly   242 IPADIVFIIRDKPHAMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEIIKPNTV 306
            |||||.|:::||.|.:|:|:||::.||.::.||:||||....:||:....:.: ...:||||.|:
Zfish   250 IPADIAFVLKDKGHPLFRRDGSNIIYTTKIGLKEALCGCTVNIPTIDNRAITL-PCNDIIKPGTI 313

  Fly   307 KRIQGYGLPFPKDTTRKGDLLVAFDIQFPEKLTAAQKEVLKDML 350
            ||::|.||||||:.:::|||:|.|.::||:::....:|::|..|
Zfish   314 KRLRGEGLPFPKNPSQRGDLIVEFQVRFPDRIPPQSREIIKQHL 357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 184/365 (50%)
DnaJ 4..65 CDD:278647 44/61 (72%)
DnaJ_C 174..338 CDD:199909 83/165 (50%)
dnajb5NP_001093510.1 DnaJ 1..355 CDD:223560 185/366 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116976445
eggNOG 1 0.900 E1_COG0484
Hieranoid 1 1.000
Homologene 1 1.000 H8176
Inparanoid 1 1.050 366 1.000 Inparanoid score I2074
OMA 1 1.010
OrthoDB 1 1.010 D1393097at2759
OrthoFinder 1 1.000 FOG0000281
OrthoInspector 1 1.000 T128691
orthoMCL 1 0.900 OOG5_126773
Panther 1 1.100 LDO PTHR24078
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1020
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.