DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and Dnajb2

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_036008391.1 Gene:Dnajb2 / 56812 MGIID:1928739 Length:365 Species:Mus musculus


Alignment Length:302 Identity:68/302 - (22%)
Similarity:104/302 - (34%) Gaps:108/302 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 KREVYDKYGEDGLKSGGTRNGGPSSN-------SFTYQFHGDPRATFAQFFGNSNPFASFFDMGD 117
            |||:||:||.:||...|:   |||.:       .||:.|. .|...|.:|||:.:||:..||   
Mouse   102 KREIYDRYGREGLTGAGS---GPSRSETGGAGPGFTFTFR-SPEEVFREFFGSGDPFSELFD--- 159

  Fly   118 NLFDKKVF-DLDTEPDFFSSPFGGIGSRHGLGSGFRPS----------FRSHSFNVHTPFKKEQK 171
               |..|| :|..:....:.||....|.....|.|..|          |||.|  ..|.|     
Mouse   160 ---DLGVFSELQNQGPRLTGPFFTFSSSFPANSDFSSSSFSFSPGAGAFRSVS--TSTTF----- 214

  Fly   172 QDPPVEHDLYVTLEEIYHGCVKKMKISRRIVQADGSSRKEEKFLAISIKPGWKSGTKVTFQKEGD 236
                                |:..:|:.|.:..:|..|.|.:          :.|...:....| 
Mouse   215 --------------------VQGRRITTRRIMENGQERVEVE----------EDGQLKSVSING- 248

  Fly   237 QAPGKIPADIVFIIRDKPHAMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEII 301
                 :|.|:...:.     :.:||                     |.|:::..   :..||  :
Mouse   249 -----VPDDLALGLE-----LSRRE---------------------QQPSVAPG---LGVMQ--V 277

  Fly   302 KPNTVKRIQGYGLPFPKDTTRKGDLLVAFDIQFPEKLTAAQK 343
            :|.::.|      |...|.:...||.:|......|...|.||
Mouse   278 RPTSLSR------PPDHDLSEDEDLQLAMAYSLSEMEAAGQK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 68/302 (23%)
DnaJ 4..65 CDD:278647 3/4 (75%)
DnaJ_C 174..338 CDD:199909 24/163 (15%)
Dnajb2XP_036008391.1 PRK14294 102..>151 CDD:237664 21/52 (40%)
UIM 291..310 CDD:197845 4/18 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844334
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.