DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5001 and Dnajb2

Sequence 1:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001153355.1 Gene:Dnajb2 MGIID:1928739 Length:324 Species:Mus musculus

Alignment Length:359 Identity:106/360 (29%)
Similarity:150/360 (42%) Gaps:110/360 (31%)


  Fly     5 YYKILGLPKTATDDEIKKAYRKLALRYHPDKN--KAANAEDKFKEVAEAYEVLSDKSKREVYDKY 67
            ||:||.:|::|:.|:|||||||.||::|||||  ....||.|||||||||||||||.|||:||:|
Mouse     4 YYEILDVPRSASPDDIKKAYRKKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRY 68

  Fly    68 GEDGLKSGGTRNGGPSSN-------SFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVF 125
            |.:||...|:   |||.:       .||:.|. .|...|.:|||:.:||:..||      |..||
Mouse    69 GREGLTGAGS---GPSRSETGGAGPGFTFTFR-SPEEVFREFFGSGDPFSELFD------DLGVF 123

  Fly   126 -DLDTEPDFFSSPFGGIGSRHGLGSGFRPS----------FRSHSFNVHTPFKKEQKQDPPVEHD 179
             :|..:....:.||....|.....|.|..|          |||.|  ..|.|             
Mouse   124 SELQNQGPRLTGPFFTFSSSFPANSDFSSSSFSFSPGAGAFRSVS--TSTTF------------- 173

  Fly   180 LYVTLEEIYHGCVKKMKISRRIVQADGSSRKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPA 244
                        |:..:|:.|.:..:|..|.|.:          :.|...:....|      :|.
Mouse   174 ------------VQGRRITTRRIMENGQERVEVE----------EDGQLKSVSING------VPD 210

  Fly   245 DIVFIIRDKPHAMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEIIKPNTVKRI 309
            |:...:.     :.:||                     |.|:::..   :..||  ::|.::.| 
Mouse   211 DLALGLE-----LSRRE---------------------QQPSVAPG---LGVMQ--VRPTSLSR- 243

  Fly   310 QGYGLPFPKDTTRKGDLLVAFDIQFPEKLTAAQK 343
                 |...|.:...||.:|......|...|.||
Mouse   244 -----PPDHDLSEDEDLQLAMAYSLSEMEAAGQK 272

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 106/360 (29%)
DnaJ 4..65 CDD:278647 42/62 (68%)
DnaJ_C 174..338 CDD:199909 24/164 (15%)
Dnajb2NP_001153355.1 DnaJ 3..>110 CDD:223560 59/110 (54%)
CAAX motif. {ECO:0000250|UniProtKB:P25686} 321..324
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C117004385
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.