DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5001 and Dnajb5

Sequence 1:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_006538171.1 Gene:Dnajb5 MGIID:1930018 Length:462 Species:Mus musculus

Alignment Length:361 Identity:191/362 (53%)
Similarity:248/362 (69%) Gaps:27/362 (7%)


  Fly     1 MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYD 65
            ||||||||||:|..|.:|||||||||:||:|||||||..|||:||||:||||:||||..||.:||
Mouse   115 MGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAEAYDVLSDPKKRSLYD 179

  Fly    66 KYGEDGLKSGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNL-----FDKKVF 125
            :|||:|||:||..:|| |..||.|.|||||.||||.|||.||||..||....:.     ||....
Mouse   180 QYGEEGLKTGGGSSGG-SGGSFHYTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFDPDDM 243

  Fly   126 DLDTEPDFFSSPFGGIG--SRHGLGSGFRPSFRSHSFNVHTP---FKKEQKQDPPVEHDLYVTLE 185
            |:|.:.|    |||..|  ..:||..|.|          ..|   :.:.:.|||||.|:|.|:||
Mouse   244 DVDEDED----PFGAFGRFGFNGLSRGPR----------RAPEPLYPRRKVQDPPVVHELRVSLE 294

  Fly   186 EIYHGCVKKMKISRRIVQADGSS-RKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFI 249
            |||||..|:|||:||.:..||.: |.|:|.|.|.||.|||.|||:||.||||..|..|||||||:
Mouse   295 EIYHGSTKRMKITRRRLNPDGRTVRTEDKILHIVIKRGWKEGTKITFPKEGDATPDNIPADIVFV 359

  Fly   250 IRDKPHAMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEIIKPNTVKRIQGYGL 314
            ::|||||.|:|:|:::.|:|.::||:||||....:||:.|..:.: ...::|||.||||::|.||
Mouse   360 LKDKPHAHFRRDGTNVLYSALISLKEALCGCTVNIPTIDGRVIPL-PCNDVIKPGTVKRLRGEGL 423

  Fly   315 PFPKDTTRKGDLLVAFDIQFPEKLTAAQKEVLKDML 350
            ||||..|::|||:|.|.::||::||...:::||..|
Mouse   424 PFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQHL 459

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 189/357 (53%)
DnaJ 4..65 CDD:278647 45/61 (74%)
DnaJ_C 174..338 CDD:199909 89/165 (54%)
Dnajb5XP_006538171.1 DnaJ 114..457 CDD:223560 190/358 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116977618
eggNOG 1 0.900 E1_COG0484
Hieranoid 1 1.000
Homologene 1 1.000 H8176
Inparanoid 1 1.050 371 1.000 Inparanoid score I2095
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1393097at2759
OrthoFinder 1 1.000 FOG0000281
OrthoInspector 1 1.000 T130953
orthoMCL 1 0.900 OOG5_126773
Panther 1 1.100 LDO PTHR24078
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1020
TreeFam 1 0.960
1312.890

Return to query results.
Submit another query.